Gene Gene information from NCBI Gene database.
Entrez ID 10775
Gene name POP4 ribonuclease P/MRP subunit
Gene symbol POP4
Synonyms (NCBI Gene)
RPP29
Chromosome 19
Chromosome location 19q12
Summary This gene encodes one of the protein subunits of the small nucleolar ribonucleoprotein complexes: the endoribonuclease for mitochondrial RNA processing complex and the ribonuclease P complex. The encoded protein is localized to the nucleus and associates
miRNA miRNA information provided by mirtarbase database.
239
miRTarBase ID miRNA Experiments Reference
MIRT029286 hsa-miR-26b-5p Microarray 19088304
MIRT049425 hsa-miR-92a-3p CLASH 23622248
MIRT045865 hsa-miR-128-3p CLASH 23622248
MIRT650776 hsa-miR-4301 HITS-CLIP 23824327
MIRT650775 hsa-miR-5088-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0000172 Component Ribonuclease MRP complex IBA
GO:0000172 Component Ribonuclease MRP complex IEA
GO:0000172 Component Ribonuclease MRP complex TAS 10352175
GO:0001682 Process TRNA 5'-leader removal IDA 16723659, 30454648
GO:0001682 Process TRNA 5'-leader removal IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606114 30081 ENSG00000105171
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95707
Protein name Ribonuclease P protein subunit p29 (hPOP4)
Protein function Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends.
PDB 6AHR , 6AHU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01868 UPF0086 128 210 Domain of unknown function UPF0086 Family
Sequence
MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFLKRSTPRMSPQAREDQLQRKAVVLEY
FTRHKRKEKKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPD
TQPQMIQAKLLKADLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKL
NCVFTVETDGFISYIYGSKFQLRSSERSAK
KFKAKGTIDL
Sequence length 220
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Ribosome biogenesis in eukaryotes   tRNA processing in the nucleus
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Nonpapillary renal cell carcinoma Likely benign rs773330218 RCV005929010
Thyroid cancer, nonmedullary, 1 Likely benign rs773330218 RCV005929011
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 22433433
Cysts Associate 33943042
Glioma Associate 29921582
Neoplasms Associate 22174824, 22433433, 39736017
Ovarian Neoplasms Associate 22174824
Pancreatic Neoplasms Associate 22377737
Polycystic Ovary Syndrome Associate 32729067
Prostatic Neoplasms Associate 19893039