Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10775
Gene name Gene Name - the full gene name approved by the HGNC.
POP4 ribonuclease P/MRP subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
POP4
Synonyms (NCBI Gene) Gene synonyms aliases
RPP29
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes one of the protein subunits of the small nucleolar ribonucleoprotein complexes: the endoribonuclease for mitochondrial RNA processing complex and the ribonuclease P complex. The encoded protein is localized to the nucleus and associates
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029286 hsa-miR-26b-5p Microarray 19088304
MIRT049425 hsa-miR-92a-3p CLASH 23622248
MIRT045865 hsa-miR-128-3p CLASH 23622248
MIRT650776 hsa-miR-4301 HITS-CLIP 23824327
MIRT650775 hsa-miR-5088-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000172 Component Ribonuclease MRP complex IBA
GO:0000172 Component Ribonuclease MRP complex IEA
GO:0000172 Component Ribonuclease MRP complex TAS 10352175
GO:0001682 Process TRNA 5'-leader removal IDA 16723659, 30454648
GO:0001682 Process TRNA 5'-leader removal IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606114 30081 ENSG00000105171
Protein
UniProt ID O95707
Protein name Ribonuclease P protein subunit p29 (hPOP4)
Protein function Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends.
PDB 6AHR , 6AHU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01868 UPF0086 128 210 Domain of unknown function UPF0086 Family
Sequence
MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFLKRSTPRMSPQAREDQLQRKAVVLEY
FTRHKRKEKKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPD
TQPQMIQAKLLKADLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKL
NCVFTVETDGFISYIYGSKFQLRSSERSAK
KFKAKGTIDL
Sequence length 220
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Ribosome biogenesis in eukaryotes   tRNA processing in the nucleus
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer specific mortality in breast cancer N/A N/A GWAS
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Diabetic Retinopathy Diabetic retinopathy N/A N/A GWAS
Hypertension Hypertension N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 22433433
Cysts Associate 33943042
Glioma Associate 29921582
Neoplasms Associate 22174824, 22433433, 39736017
Ovarian Neoplasms Associate 22174824
Pancreatic Neoplasms Associate 22377737
Polycystic Ovary Syndrome Associate 32729067
Prostatic Neoplasms Associate 19893039