Gene Gene information from NCBI Gene database.
Entrez ID 10772
Gene name Serine and arginine rich splicing factor 10
Gene symbol SRSF10
Synonyms (NCBI Gene)
FUSIP1FUSIP2NSSRPPP1R149SFRS13SFRS13ASRp38SRrp40TASRTASR1TASR2
Chromosome 1
Chromosome location 1p36.11
Summary This gene product is a member of the serine-arginine (SR) family of proteins, which are involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA
miRNA miRNA information provided by mirtarbase database.
453
miRTarBase ID miRNA Experiments Reference
MIRT003994 hsa-miR-29c-3p Luciferase reporter assay 18390668
MIRT003994 hsa-miR-29c-3p Luciferase reporter assay 18390668
MIRT003994 hsa-miR-29c-3p Luciferase reporter assay 18390668
MIRT003994 hsa-miR-29c-3p Reporter assay 18390668
MIRT048638 hsa-miR-99a-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
36
GO ID Ontology Definition Evidence Reference
GO:0000244 Process Spliceosomal tri-snRNP complex assembly NAS 11684676
GO:0000375 Process RNA splicing, via transesterification reactions IDA 9774382
GO:0000375 Process RNA splicing, via transesterification reactions IEA
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IBA
GO:0000398 Process MRNA splicing, via spliceosome IDA 9774382
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605221 16713 ENSG00000188529
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75494
Protein name Serine/arginine-rich splicing factor 10 (40 kDa SR-repressor protein) (SRrp40) (FUS-interacting serine-arginine-rich protein 1) (Splicing factor SRp38) (Splicing factor, arginine/serine-rich 13A) (TLS-associated protein with Ser-Arg repeats) (TASR) (TLS-a
Protein function Splicing factor that in its dephosphorylated form acts as a general repressor of pre-mRNA splicing (PubMed:11684676, PubMed:12419250, PubMed:14765198). Seems to interfere with the U1 snRNP 5'-splice recognition of SNRNP70 (PubMed:14765198). Requ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 12 82 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:11684676, ECO:0000269|PubMed:11891055}.
Sequence
MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFED
VRDAEDALHNLDRKWICGRQIE
IQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSR
SRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNSR
SRSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQSR
SQSRSRSKSRSRSWTSPKSSGH
Sequence length 262
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Spliceosome   mRNA Splicing - Major Pathway