TNFSF13B (TNF superfamily member 13b)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 10673
Gene name TNF superfamily member 13b
Gene symbol TNFSF13B
Synonyms (NCBI Gene)
BAFFBLYSCD257DTLTALL-1TALL1THANKTNFSF20TNLG7AZTNF4
Chromosome 13
Chromosome location 13q33.3
Summary The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR. This cytokine is expressed in B cell lineage cells, a
miRNA miRNA information provided by mirtarbase database.
35
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (35)
miRTarBase ID miRNA Experiments Reference
MIRT024564 hsa-miR-215-5p Microarray 19074876
MIRT026689 hsa-miR-192-5p Microarray 19074876
MIRT1443368 hsa-miR-1200 CLIP-seq
MIRT1443369 hsa-miR-3173-3p CLIP-seq
MIRT1443370 hsa-miR-4324 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2)
Transcription factor Regulation Reference
NFKB1 Unknown 16497967
STAT1 Unknown 23271704
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
41
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (41)
GO ID Ontology Definition Evidence Reference
GO:0001782 Process B cell homeostasis IEA
GO:0002260 Process Lymphocyte homeostasis IBA
GO:0002333 Process Transitional one stage B cell differentiation IEA
GO:0002376 Process Immune system process IEA
GO:0002467 Process Germinal center formation IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
603969 11929 ENSG00000102524
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y275
Protein name Tumor necrosis factor ligand superfamily member 13B (B lymphocyte stimulator) (BLyS) (B-cell-activating factor) (BAFF) (Dendritic cell-derived TNF-like molecule) (TNF- and APOL-related leukocyte expressed ligand 1) (TALL-1) (CD antigen CD257) [Cleaved int
Protein function Cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA. TNFSF13/APRIL binds to the same 2 receptors. Together, they form a 2 ligands -2 receptors pathway involved in the stimulation of B- and T-cell function and the regulation of humoral immuni
PDB 1JH5 , 1KD7 , 1KXG , 1OQD , 1OQE , 1OSG , 3V56 , 4V46 , 4ZCH , 5Y9J , 6FXN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00229 TNF 169 → 284 TNF(Tumour Necrosis Factor) family Domain
Tissue specificity TISSUE SPECIFICITY: Abundantly expressed in peripheral blood Leukocytes and is specifically expressed in monocytes and macrophages. Also found in the spleen, lymph node, bone marrow, T-cells and dendritic cells. A lower expression seen in placenta, heart,
Sequence 
MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGKLLAATLLLALLSCC
LTVVSFYQVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP
GEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEE
KENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETL
PNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
Sequence length 285
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Intestinal immune network for IgA production
Rheumatoid arthritis 		  TNFR2 non-canonical NF-kB pathway
TNFs bind their physiological receptors
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (3)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
MOOD DISORDERS — Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NEUTROPENIA — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (185)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Abortion Spontaneous Associate 36096448
★★★★★
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Associate 37333771
★★★★★
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Stimulate 36722235
★★★★★
★☆☆☆☆
Found in Text Mining only
Anti N Methyl D Aspartate Receptor Encephalitis Stimulate 36544777
★★★★★
★☆☆☆☆
Found in Text Mining only
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis Associate 36906660
★★★★★
★☆☆☆☆
Found in Text Mining only
Antiphospholipid Syndrome Associate 34079038
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthralgia Stimulate 29720240
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Stimulate 12687540, 29720240
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Associate 17530706, 19627580, 21515993, 21557212, 23001900, 23684916, 25360821, 28383556, 30586461, 33483588, 34281218, 35411715
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Stimulate 17907168, 29720240, 30369929
★★★★★
★☆☆☆☆
Found in Text Mining only