TNFSF13B (TNF superfamily member 13b)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10673
Gene name Gene Name - the full gene name approved by the HGNC.
TNF superfamily member 13b
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TNFSF13B
Synonyms (NCBI Gene) Gene synonyms aliases
BAFF, BLYS, CD257, DTL, TALL-1, TALL1, THANK, TNFSF20, TNLG7A, ZTNF4
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q33.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR. This cytokine is expressed in B cell lineage cells, a
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(35)
miRTarBase ID miRNA Experiments Reference
MIRT024564 hsa-miR-215-5p Microarray 19074876
MIRT026689 hsa-miR-192-5p Microarray 19074876
MIRT1443368 hsa-miR-1200 CLIP-seq
MIRT1443369 hsa-miR-3173-3p CLIP-seq
MIRT1443370 hsa-miR-4324 CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
Transcription factor Regulation Reference
NFKB1 Unknown 16497967
STAT1 Unknown 23271704
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(23)
GO ID Ontology Definition Evidence Reference
GO:0001782 Process B cell homeostasis IEA
GO:0002636 Process Positive regulation of germinal center formation IEA
GO:0005125 Function Cytokine activity IEA
GO:0005164 Function Tumor necrosis factor receptor binding IEA
GO:0005515 Function Protein binding IPI 10801128, 10880535, 10956646, 30833792
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
603969 11929 ENSG00000102524
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9Y275
Protein name Tumor necrosis factor ligand superfamily member 13B (B lymphocyte stimulator) (BLyS) (B-cell-activating factor) (BAFF) (Dendritic cell-derived TNF-like molecule) (TNF- and APOL-related leukocyte expressed ligand 1) (TALL-1) (CD antigen CD257) [Cleaved int
Protein function Cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA. TNFSF13/APRIL binds to the same 2 receptors. Together, they form a 2 ligands -2 receptors pathway involved in the stimulation of B- and T-cell function and the regulation of humoral immuni
PDB 1JH5 , 1KD7 , 1KXG , 1OQD , 1OQE , 1OSG , 3V56 , 4V46 , 4ZCH , 5Y9J , 6FXN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00229 TNF 169 → 284 TNF(Tumour Necrosis Factor) family Domain
Tissue specificity TISSUE SPECIFICITY: Abundantly expressed in peripheral blood Leukocytes and is specifically expressed in monocytes and macrophages. Also found in the spleen, lymph node, bone marrow, T-cells and dendritic cells. A lower expression seen in placenta, heart,
Sequence 
MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGKLLAATLLLALLSCC
LTVVSFYQVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP
GEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEE
KENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETL
PNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
Sequence length 285
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Intestinal immune network for IgA production
Rheumatoid arthritis 		  TNFR2 non-canonical NF-kB pathway
TNFs bind their physiological receptors
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Renal Carcinoma Renal Carcinoma GWAS
Show/Hide Text Mining Associations (185)
Associations from Text Mining
Disease Name Relationship Type References
Abortion Spontaneous Associate 36096448
Alzheimer Disease Associate 37333771
Amyotrophic Lateral Sclerosis Stimulate 36722235
Anti N Methyl D Aspartate Receptor Encephalitis Stimulate 36544777
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis Associate 36906660
Antiphospholipid Syndrome Associate 34079038
Arthralgia Stimulate 29720240
Arthritis Stimulate 12687540, 29720240
Arthritis Rheumatoid Associate 17530706, 19627580, 21515993, 21557212, 23001900, 23684916, 25360821, 28383556, 30586461, 33483588, 34281218, 35411715
Arthritis Rheumatoid Stimulate 17907168, 29720240, 30369929