Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10654
Gene name Gene Name - the full gene name approved by the HGNC.
Phosphomevalonate kinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PMVK
Synonyms (NCBI Gene) Gene synonyms aliases
HUMPMKI, PMK, PMKA, PMKASE, POROK1
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a peroxisomal enzyme that is a member of the galactokinase, homoserine kinase, mevalonate kinase, and phosphomevalonate kinase (GHMP) family of ATP-dependent enzymes. The encoded protein catalyzes the conversion of mevalonate 5-phosphate
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs745983207 G>A Pathogenic Stop gained, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1244673 hsa-miR-140-3p CLIP-seq
MIRT1244674 hsa-miR-146a CLIP-seq
MIRT1244675 hsa-miR-146b-5p CLIP-seq
MIRT1244676 hsa-miR-2467-3p CLIP-seq
MIRT1244677 hsa-miR-3140-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0004631 Function Phosphomevalonate kinase activity IBA
GO:0004631 Function Phosphomevalonate kinase activity IDA 8663599, 14680974, 16519518
GO:0004631 Function Phosphomevalonate kinase activity IEA
GO:0004631 Function Phosphomevalonate kinase activity TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607622 9141 ENSG00000163344
Protein
UniProt ID Q15126
Protein name Phosphomevalonate kinase (PMKase) (hPMK) (EC 2.7.4.2)
Protein function Catalyzes the reversible ATP-dependent phosphorylation of mevalonate 5-phosphate to produce mevalonate diphosphate and ADP, a key step in the mevalonic acid mediated biosynthesis of isopentenyl diphosphate and other polyisoprenoid metabolites. {
PDB 3CH4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04275 P-mevalo_kinase 14 124 Phosphomevalonate kinase Family
Tissue specificity TISSUE SPECIFICITY: Heart, liver, skeletal muscle, kidney, and pancreas. Lower level in brain, placenta and lung. {ECO:0000269|PubMed:8663599}.
Sequence
MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQ
RLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFRE
AYGA
VTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQ
LENLIEFIRSRL
Sequence length 192
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Terpenoid backbone biosynthesis
Metabolic pathways
Peroxisome
  Cholesterol biosynthesis
Activation of gene expression by SREBF (SREBP)
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Bipolar Disorder Bipolar disorder N/A N/A GWAS
Dyslexia Dyslexia N/A N/A GWAS
Parkinson disease Parkinson disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Atrial Fibrillation Inhibit 37581400
Nevus Sebaceous of Jadassohn Associate 35853659
Porokeratosis Associate 26202976, 27052676, 30942823, 35853659, 37315547
Pyruvate Kinase Deficiency of Red Cells Associate 27052676
Trigeminal Neuralgia Associate 38158702