Gene Gene information from NCBI Gene database.
Entrez ID 10654
Gene name Phosphomevalonate kinase
Gene symbol PMVK
Synonyms (NCBI Gene)
HUMPMKIPMKPMKAPMKASEPOROK1
Chromosome 1
Chromosome location 1q21.3
Summary This gene encodes a peroxisomal enzyme that is a member of the galactokinase, homoserine kinase, mevalonate kinase, and phosphomevalonate kinase (GHMP) family of ATP-dependent enzymes. The encoded protein catalyzes the conversion of mevalonate 5-phosphate
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs745983207 G>A Pathogenic Stop gained, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
137
miRTarBase ID miRNA Experiments Reference
MIRT1244673 hsa-miR-140-3p CLIP-seq
MIRT1244674 hsa-miR-146a CLIP-seq
MIRT1244675 hsa-miR-146b-5p CLIP-seq
MIRT1244676 hsa-miR-2467-3p CLIP-seq
MIRT1244677 hsa-miR-3140-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
31
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0004631 Function Phosphomevalonate kinase activity IBA
GO:0004631 Function Phosphomevalonate kinase activity IDA 8663599, 14680974, 16519518
GO:0004631 Function Phosphomevalonate kinase activity IEA
GO:0004631 Function Phosphomevalonate kinase activity TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607622 9141 ENSG00000163344
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15126
Protein name Phosphomevalonate kinase (PMKase) (hPMK) (EC 2.7.4.2)
Protein function Catalyzes the reversible ATP-dependent phosphorylation of mevalonate 5-phosphate to produce mevalonate diphosphate and ADP, a key step in the mevalonic acid mediated biosynthesis of isopentenyl diphosphate and other polyisoprenoid metabolites. {
PDB 3CH4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04275 P-mevalo_kinase 14 124 Phosphomevalonate kinase Family
Tissue specificity TISSUE SPECIFICITY: Heart, liver, skeletal muscle, kidney, and pancreas. Lower level in brain, placenta and lung. {ECO:0000269|PubMed:8663599}.
Sequence
MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQ
RLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFRE
AYGA
VTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQ
LENLIEFIRSRL
Sequence length 192
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Terpenoid backbone biosynthesis
Metabolic pathways
Peroxisome
  Cholesterol biosynthesis
Activation of gene expression by SREBF (SREBP)
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
15
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Linear porokeratosis Likely pathogenic; Pathogenic rs373000976, rs140728783, rs2101965598 RCV001849504
RCV001849670
RCV001849672
PMVK-related disorder Likely pathogenic; Pathogenic rs373000976 RCV003399087
Porokeratosis 1, Mibelli type Likely pathogenic; Pathogenic rs373000976, rs745983207, rs879255607 RCV003135955
RCV004576932
RCV004576933
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
PMVK-associated autoinflammatory disorder Uncertain significance rs779946272 RCV003986070
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Atrial Fibrillation Inhibit 37581400
Nevus Sebaceous of Jadassohn Associate 35853659
Porokeratosis Associate 26202976, 27052676, 30942823, 35853659, 37315547
Pyruvate Kinase Deficiency of Red Cells Associate 27052676
Trigeminal Neuralgia Associate 38158702