Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10636
Gene name Gene Name - the full gene name approved by the HGNC.	Regulator of G protein signaling 14
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RGS14
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q35.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the regulator of G-protein signaling family. This protein contains one RGS domain, two Raf-like Ras-binding domains (RBDs), and one GoLoco domain. The protein attenuates the signaling activity of G-proteins by binding, throug

Show/Hide all(38)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021874	hsa-miR-128-3p	Microarray	17612493
MIRT1304136	hsa-miR-3151	CLIP-seq
MIRT1304137	hsa-miR-342-5p	CLIP-seq
MIRT1304138	hsa-miR-3650	CLIP-seq
MIRT1304139	hsa-miR-3652	CLIP-seq
MIRT1304140	hsa-miR-378	CLIP-seq
MIRT1304141	hsa-miR-378b	CLIP-seq
MIRT1304142	hsa-miR-378c	CLIP-seq
MIRT1304143	hsa-miR-378d	CLIP-seq
MIRT1304144	hsa-miR-378e	CLIP-seq
MIRT1304145	hsa-miR-378f	CLIP-seq
MIRT1304146	hsa-miR-378h	CLIP-seq
MIRT1304147	hsa-miR-378i	CLIP-seq
MIRT1304148	hsa-miR-422a	CLIP-seq
MIRT1304149	hsa-miR-4430	CLIP-seq
MIRT1304150	hsa-miR-4447	CLIP-seq
MIRT1304151	hsa-miR-4455	CLIP-seq
MIRT1304152	hsa-miR-4472	CLIP-seq
MIRT1304153	hsa-miR-4492	CLIP-seq
MIRT1304154	hsa-miR-4498	CLIP-seq
MIRT1304155	hsa-miR-4651	CLIP-seq
MIRT1304156	hsa-miR-4664-5p	CLIP-seq
MIRT1304157	hsa-miR-4711-3p	CLIP-seq
MIRT1304158	hsa-miR-491-5p	CLIP-seq
MIRT1304159	hsa-miR-608	CLIP-seq
MIRT1304160	hsa-miR-762	CLIP-seq
MIRT1304161	hsa-miR-885-3p	CLIP-seq
MIRT1304136	hsa-miR-3151	CLIP-seq
MIRT1304137	hsa-miR-342-5p	CLIP-seq
MIRT1304138	hsa-miR-3650	CLIP-seq
MIRT1304150	hsa-miR-4447	CLIP-seq
MIRT1304151	hsa-miR-4455	CLIP-seq
MIRT1304152	hsa-miR-4472	CLIP-seq
MIRT1304155	hsa-miR-4651	CLIP-seq
MIRT1304156	hsa-miR-4664-5p	CLIP-seq
MIRT1304158	hsa-miR-491-5p	CLIP-seq
MIRT1304159	hsa-miR-608	CLIP-seq
MIRT1304161	hsa-miR-885-3p	CLIP-seq

Show/Hide all(45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	IEA
GO:0000922	Component	Spindle pole	ISS
GO:0001965	Function	G-protein alpha-subunit binding	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005092	Function	GDP-dissociation inhibitor activity	IDA	15917656
GO:0005096	Function	GTPase activator activity	IDA	15917656
GO:0005515	Function	Protein binding	IPI	21044950, 21988832, 32296183
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	ISS
GO:0005813	Component	Centrosome	ISS
GO:0005819	Component	Spindle	IDA	15917656
GO:0005874	Component	Microtubule	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006913	Process	Nucleocytoplasmic transport	ISS
GO:0006979	Process	Response to oxidative stress	ISS
GO:0007051	Process	Spindle organization	IMP	15917656
GO:0007059	Process	Chromosome segregation	ISS
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007612	Process	Learning	ISS
GO:0007616	Process	Long-term memory	ISS
GO:0008017	Function	Microtubule binding	IDA	15917656
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	TAS	9168931
GO:0008542	Process	Visual learning	ISS
GO:0010070	Process	Zygote asymmetric cell division	ISS
GO:0014069	Component	Postsynaptic density	ISS
GO:0016604	Component	Nuclear body	ISS
GO:0016605	Component	PML body	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0030159	Function	Signaling receptor complex adaptor activity	ISS
GO:0030425	Component	Dendrite	ISS
GO:0031914	Process	Negative regulation of synaptic plasticity	ISS
GO:0032794	Function	GTPase activating protein binding	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0043197	Component	Dendritic spine	ISS
GO:0043407	Process	Negative regulation of MAP kinase activity	ISS
GO:0043547	Process	Positive regulation of GTPase activity	IEA
GO:0043620	Process	Regulation of DNA-templated transcription in response to stress	ISS
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	ISS
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	ISS
GO:0050769	Process	Positive regulation of neurogenesis	ISS
GO:0051301	Process	Cell division	IMP	17635935
GO:0060291	Process	Long-term synaptic potentiation	ISS
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	ISS
GO:0098978	Component	Glutamatergic synapse	IEA

MIM	HGNC	e!Ensembl
602513	9996	ENSG00000169220

Protein

UniProt ID

O43566

Protein name

Regulator of G-protein signaling 14 (RGS14)

Protein function

Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Besides, modulates signal transduction

PDB

2JNU , 2OM2 , 2XNS , 3ONW , 3QI2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00615	RGS	67 → 183	Regulator of G protein signaling domain	Domain
PF02196	RBD	303 → 370	Raf-like Ras-binding domain	Domain
PF02196	RBD	383 → 442	Raf-like Ras-binding domain	Domain
PF02188	GoLoco	499 → 520	GoLoco motif	Motif

Sequence

MPGKPKHLGVPNGRMVLAVSDGELSSTTGPQGQGEGRGSSLSIHSLPSGPSSPFPTEEQP
VASWALSFERLLQDPLGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTQQLAQEARN
IYQEFLSSQALSPVNIDRQAWLGEEVLAEPRPDMFRAQQLQIFNLMKFDSYARFVKSPLY
RECLLAEAEGRPLREPGSSRLGSPDATRKKPKLKPGKSLPLGVEELGQLPPVEGPGGRPL
RKSFRRELGGTANAALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSTEGESESRP
GKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNEQALVLDQDCT
VLADQEVRLENRITFELELTALERVVRISAKPTKRLQEALQPILEKHGLSPLEVVLHRPG
EKQPLDLGKLVSSVAAQRLVLDTLPGVKISKARDKSPCRSQGCPPRTQDKATHPPPASPS
SLVKVPSSATGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPAQGPSS
EETPPQTKSAAQPIGGSLNSTTDSAL

Sequence length

566

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway		G alpha (i) signalling events

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Inflammatory bowel disease	Inflammatory Bowel Diseases	rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468	26192919, 23128233, 28067908
Multiple sclerosis	Multiple Sclerosis	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039 View all (4 more)	24076602

Show/Hide Unknown Diseases (13)

Disease term	Disease name	References	Source
Unknown
Crohn disease	Crohn Disease	26192919	ClinVar
Eczema	Eczema		GWAS
Multiple Sclerosis	Multiple Sclerosis		GWAS
Nephrolithiasis	Nephrolithiasis		GWAS
Inflammatory Bowel Disease	Inflammatory Bowel Disease		GWAS
Kidney Disease	Kidney Disease		GWAS
Gout	Gout		GWAS
Urolithiasis	Urolithiasis		GWAS
Ulcerative colitis	Ulcerative colitis		GWAS
Crohn Disease	Crohn Disease		GWAS
Metabolic Syndrome	Metabolic Syndrome		GWAS
Dermatitis	Dermatitis		GWAS
Psoriasis	Psoriasis		GWAS

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Chronic Kidney Disease Mineral and Bone Disorder	Associate	35587600
Hyperparathyroidism	Associate	35587600
Hyperphosphatemia	Associate	35307350
Inflammatory Bowel Diseases	Associate	37988718
Kidney Diseases	Associate	35307350
Multiple Sclerosis	Associate	25526461
Neoplasms	Associate	36384958
Nephrolithiasis	Associate	22396660, 28361944, 31754202
Nephrolithiasis Calcium Oxalate	Associate	31754202
Renal Insufficiency Chronic	Associate	35587600
Urolithiasis	Associate	28361944

RGS14 (regulator of G protein signaling 14)