Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	10636
Gene name	Regulator of G protein signaling 14
Gene symbol	RGS14
Synonyms (NCBI Gene)	-
Chromosome	5
Chromosome location	5q35.3
Summary	This gene encodes a member of the regulator of G-protein signaling family. This protein contains one RGS domain, two Raf-like Ras-binding domains (RBDs), and one GoLoco domain. The protein attenuates the signaling activity of G-proteins by binding, throug

Show/Hide all (38)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021874	hsa-miR-128-3p	Microarray	17612493
MIRT1304136	hsa-miR-3151	CLIP-seq
MIRT1304137	hsa-miR-342-5p	CLIP-seq
MIRT1304138	hsa-miR-3650	CLIP-seq
MIRT1304139	hsa-miR-3652	CLIP-seq
MIRT1304140	hsa-miR-378	CLIP-seq
MIRT1304141	hsa-miR-378b	CLIP-seq
MIRT1304142	hsa-miR-378c	CLIP-seq
MIRT1304143	hsa-miR-378d	CLIP-seq
MIRT1304144	hsa-miR-378e	CLIP-seq
MIRT1304145	hsa-miR-378f	CLIP-seq
MIRT1304146	hsa-miR-378h	CLIP-seq
MIRT1304147	hsa-miR-378i	CLIP-seq
MIRT1304148	hsa-miR-422a	CLIP-seq
MIRT1304149	hsa-miR-4430	CLIP-seq
MIRT1304150	hsa-miR-4447	CLIP-seq
MIRT1304151	hsa-miR-4455	CLIP-seq
MIRT1304152	hsa-miR-4472	CLIP-seq
MIRT1304153	hsa-miR-4492	CLIP-seq
MIRT1304154	hsa-miR-4498	CLIP-seq
MIRT1304155	hsa-miR-4651	CLIP-seq
MIRT1304156	hsa-miR-4664-5p	CLIP-seq
MIRT1304157	hsa-miR-4711-3p	CLIP-seq
MIRT1304158	hsa-miR-491-5p	CLIP-seq
MIRT1304159	hsa-miR-608	CLIP-seq
MIRT1304160	hsa-miR-762	CLIP-seq
MIRT1304161	hsa-miR-885-3p	CLIP-seq
MIRT1304136	hsa-miR-3151	CLIP-seq
MIRT1304137	hsa-miR-342-5p	CLIP-seq
MIRT1304138	hsa-miR-3650	CLIP-seq
MIRT1304150	hsa-miR-4447	CLIP-seq
MIRT1304151	hsa-miR-4455	CLIP-seq
MIRT1304152	hsa-miR-4472	CLIP-seq
MIRT1304155	hsa-miR-4651	CLIP-seq
MIRT1304156	hsa-miR-4664-5p	CLIP-seq
MIRT1304158	hsa-miR-491-5p	CLIP-seq
MIRT1304159	hsa-miR-608	CLIP-seq
MIRT1304161	hsa-miR-885-3p	CLIP-seq

Show/Hide all (91)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	IEA
GO:0000922	Component	Spindle pole	IEA
GO:0000922	Component	Spindle pole	ISS
GO:0001965	Function	G-protein alpha-subunit binding	IEA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005092	Function	GDP-dissociation inhibitor activity	IDA	15917656
GO:0005092	Function	GDP-dissociation inhibitor activity	IEA
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IDA	15917656
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS	9168931
GO:0005515	Function	Protein binding	IPI	21044950, 21988832, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005813	Component	Centrosome	IEA
GO:0005813	Component	Centrosome	ISS
GO:0005819	Component	Spindle	IDA	15917656
GO:0005819	Component	Spindle	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006913	Process	Nucleocytoplasmic transport	IEA
GO:0006913	Process	Nucleocytoplasmic transport	ISS
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006979	Process	Response to oxidative stress	ISS
GO:0007051	Process	Spindle organization	IBA
GO:0007051	Process	Spindle organization	IEA
GO:0007051	Process	Spindle organization	IMP	15917656
GO:0007059	Process	Chromosome segregation	IEA
GO:0007059	Process	Chromosome segregation	ISS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007612	Process	Learning	IEA
GO:0007612	Process	Learning	ISS
GO:0007616	Process	Long-term memory	IBA
GO:0007616	Process	Long-term memory	IEA
GO:0007616	Process	Long-term memory	ISS
GO:0008017	Function	Microtubule binding	IDA	15917656
GO:0008017	Function	Microtubule binding	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IBA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	TAS	9168931
GO:0008542	Process	Visual learning	IEA
GO:0008542	Process	Visual learning	ISS
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0010070	Process	Zygote asymmetric cell division	IEA
GO:0010070	Process	Zygote asymmetric cell division	ISS
GO:0014069	Component	Postsynaptic density	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0016020	Component	Membrane	IEA
GO:0016604	Component	Nuclear body	IEA
GO:0016604	Component	Nuclear body	ISS
GO:0016605	Component	PML body	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0030159	Function	Signaling receptor complex adaptor activity	IEA
GO:0030159	Function	Signaling receptor complex adaptor activity	ISS
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0030695	Function	GTPase regulator activity	IEA
GO:0031914	Process	Negative regulation of synaptic plasticity	IEA
GO:0031914	Process	Negative regulation of synaptic plasticity	ISS
GO:0032794	Function	GTPase activating protein binding	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0043197	Component	Dendritic spine	ISS
GO:0043407	Process	Negative regulation of MAP kinase activity	ISS
GO:0045202	Component	Synapse	IEA
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	IEA
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	ISS
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IEA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	ISS
GO:0050769	Process	Positive regulation of neurogenesis	IEA
GO:0050769	Process	Positive regulation of neurogenesis	ISS
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0051301	Process	Cell division	IBA
GO:0051301	Process	Cell division	IEA
GO:0051301	Process	Cell division	IMP	17635935
GO:0060291	Process	Long-term synaptic potentiation	IBA
GO:0060291	Process	Long-term synaptic potentiation	IEA
GO:0060291	Process	Long-term synaptic potentiation	ISS
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	ISS
GO:0098978	Component	Glutamatergic synapse	IEA

MIM	HGNC	e!Ensembl
602513	9996	ENSG00000169220

O43566

Protein name

Regulator of G-protein signaling 14 (RGS14)

Protein function

Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Besides, modulates signal transduction

PDB

2JNU , 2OM2 , 2XNS , 3ONW , 3QI2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00615	RGS	67 → 183	Regulator of G protein signaling domain	Domain
PF02196	RBD	303 → 370	Raf-like Ras-binding domain	Domain
PF02196	RBD	383 → 442	Raf-like Ras-binding domain	Domain
PF02188	GoLoco	499 → 520	GoLoco motif	Motif

Sequence

MPGKPKHLGVPNGRMVLAVSDGELSSTTGPQGQGEGRGSSLSIHSLPSGPSSPFPTEEQP
VASWALSFERLLQDPLGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTQQLAQEARN
IYQEFLSSQALSPVNIDRQAWLGEEVLAEPRPDMFRAQQLQIFNLMKFDSYARFVKSPLY
RECLLAEAEGRPLREPGSSRLGSPDATRKKPKLKPGKSLPLGVEELGQLPPVEGPGGRPL
RKSFRRELGGTANAALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSTEGESESRP
GKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNEQALVLDQDCT
VLADQEVRLENRITFELELTALERVVRISAKPTKRLQEALQPILEKHGLSPLEVVLHRPG
EKQPLDLGKLVSSVAAQRLVLDTLPGVKISKARDKSPCRSQGCPPRTQDKATHPPPASPS
SLVKVPSSATGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPAQGPSS
EETPPQTKSAAQPIGGSLNSTTDSAL

Sequence length

566

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway		G alpha (i) signalling events

RGS14 (regulator of G protein signaling 14)