Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10634
Gene name Gene Name - the full gene name approved by the HGNC.	Growth arrest specific 2 like 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GAS2L1
Synonyms (NCBI Gene) Gene synonyms aliases	GAR22
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q12.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the growth arrest-specific 2 protein family. This protein binds components of the cytoskeleton and may be involved in mediating interactions between microtubules and microfilaments. This protein localizes to the proximal end

Show/Hide all(43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002903	hsa-miR-124-3p	Microarray, qRT-PCR	16549876
MIRT002903	hsa-miR-124-3p	qRT-PCR;Other	16549876
MIRT1012262	hsa-miR-1915	CLIP-seq
MIRT1012263	hsa-miR-3125	CLIP-seq
MIRT1012264	hsa-miR-3916	CLIP-seq
MIRT1012265	hsa-miR-451b	CLIP-seq
MIRT1012266	hsa-miR-4640-5p	CLIP-seq
MIRT1012267	hsa-miR-4726-3p	CLIP-seq
MIRT1012268	hsa-miR-4726-5p	CLIP-seq
MIRT1921611	hsa-miR-1976	CLIP-seq
MIRT1921612	hsa-miR-483-3p	CLIP-seq
MIRT1921611	hsa-miR-1976	CLIP-seq
MIRT1921612	hsa-miR-483-3p	CLIP-seq
MIRT2233263	hsa-miR-1	CLIP-seq
MIRT2233264	hsa-miR-125a-5p	CLIP-seq
MIRT2233265	hsa-miR-125b	CLIP-seq
MIRT2233266	hsa-miR-1827	CLIP-seq
MIRT2233267	hsa-miR-206	CLIP-seq
MIRT2233268	hsa-miR-2467-3p	CLIP-seq
MIRT2233269	hsa-miR-298	CLIP-seq
MIRT2233270	hsa-miR-3144-5p	CLIP-seq
MIRT2233271	hsa-miR-3154	CLIP-seq
MIRT2233272	hsa-miR-3191	CLIP-seq
MIRT2233273	hsa-miR-361-3p	CLIP-seq
MIRT2233274	hsa-miR-4257	CLIP-seq
MIRT2233275	hsa-miR-4283	CLIP-seq
MIRT2233276	hsa-miR-4289	CLIP-seq
MIRT2233277	hsa-miR-4319	CLIP-seq
MIRT2233278	hsa-miR-4652-5p	CLIP-seq
MIRT2233279	hsa-miR-4667-5p	CLIP-seq
MIRT2233280	hsa-miR-4700-5p	CLIP-seq
MIRT2233281	hsa-miR-4717-5p	CLIP-seq
MIRT2233282	hsa-miR-4732-3p	CLIP-seq
MIRT2233283	hsa-miR-4753-5p	CLIP-seq
MIRT2233284	hsa-miR-574-3p	CLIP-seq
MIRT2233285	hsa-miR-613	CLIP-seq
MIRT2233286	hsa-miR-615-5p	CLIP-seq
MIRT2233287	hsa-miR-637	CLIP-seq
MIRT2233288	hsa-miR-670	CLIP-seq
MIRT2450058	hsa-miR-3918	CLIP-seq
MIRT2450059	hsa-miR-4632	CLIP-seq
MIRT2450060	hsa-miR-4691-3p	CLIP-seq
MIRT2450061	hsa-miR-4707-3p	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IBA	21873635
GO:0001578	Process	Microtubule bundle formation	IMP	24706950
GO:0005515	Function	Protein binding	IPI	24706950, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005884	Component	Actin filament	IMP	24706950
GO:0007050	Process	Cell cycle arrest	ISS	12584248
GO:0008017	Function	Microtubule binding	IBA	21873635
GO:0008093	Function	Cytoskeletal anchor activity	IBA	21873635
GO:0009267	Process	Cellular response to starvation	ISS	12584248
GO:0031110	Process	Regulation of microtubule polymerization or depolymerization	IMP	24706950
GO:0035371	Component	Microtubule plus-end	IMP	24706950
GO:0046966	Function	Thyroid hormone receptor binding	IDA	19375645
GO:0051015	Function	Actin filament binding	IBA	21873635
GO:0051764	Process	Actin crosslink formation	IBA	21873635
GO:0097067	Process	Cellular response to thyroid hormone stimulus	IDA	19375645
GO:1904825	Process	Protein localization to microtubule plus-end	IDA	24706950

MIM	HGNC	e!Ensembl
602128	16955	ENSG00000185340

Protein

UniProt ID

Q99501

Protein name

GAS2-like protein 1 (GAS2-related protein on chromosome 22) (Growth arrest-specific protein 2-like 1)

Protein function

Involved in the cross-linking of microtubules and microfilaments (PubMed:12584248, PubMed:24706950). Regulates microtubule dynamics and stability by interacting with microtubule plus-end tracking proteins, such as MAPRE1, to regulate microtubule

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00307	CH	27 → 149	Calponin homology (CH) domain	Domain
PF02187	GAS2	208 → 276	Growth-Arrest-Specific Protein 2 Domain	Family

Sequence

MADPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLAEWLNALYGLGLPGGGDGFLTGLATGT
TLCQHANAVTEAARALAAARPARGVAFQAHSVVPGSFMARDNVATFIGWCRVELGVPEVL
MFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIERELRAAPPAPNAPAA
GEDTTETAPAPGTPARGPRMTPSDLRNLDELVREILGRCTCPDQFPMIKVSEGKYRVGDS
SLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSSTAHRPPQPRVCTFSPQRVSPTT
SPRPASPVPGSERRGSRPEMTPVSLRSTKEGPETPPRPRDQLPPHPRSRRYSGDSDSSAS
SAQSGPLGTRSDDTGTGPRRERPSRRLTTGTPASPRRPPALRSQSRDRLDRGRPRGAPGG
RGAQLSVPSPARRARSQSREEQAVLLVRRDRDGQHSWVPRGRGSGGSGRSTPQTPRARSP
AAPRLSRVSSPSPELGTTPASIFRTPLQLDPQQEQQLFRRLEEEFLANARALEAVASVTP
TGPVPDPARAPDPPAPDSAYCSSSSSSSSLSVLGGKCGQPGDSGRTANGLPGPRSQALSS
SSDEGSPCPGMGGPLDAPGSPLACTEPSRTWARGRMDTQPDRKPSRIPTPRGPRRPSGPA
ELGTWHALHSVTPRAEPDSWM

Sequence length

681

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Leukemia	Leukemia, Myelocytic, Acute, Acute Myeloid Leukemia (AML-M2)	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	17330099

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining
Dementia Vascular	Associate	38320734
Glioma	Associate	33713047
Neoplasms	Inhibit	19375645

GAS2L1 (growth arrest specific 2 like 1)