Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10620
Gene name Gene Name - the full gene name approved by the HGNC.
AT-rich interaction domain 3B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ARID3B
Synonyms (NCBI Gene) Gene synonyms aliases
BDP, DRIL2
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q24.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the ARID (AT-rich interaction domain) family of DNA-binding proteins. The encoded protein is homologous with two proteins that bind to the retinoblastoma gene product, and also with the mouse Bright and Drosophila dead ringer
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005419 hsa-miR-125a-5p Immunofluorescence, qRT-PCR, Western blot 19881956
MIRT005419 hsa-miR-125a-5p Immunofluorescence, qRT-PCR, Western blot 19881956
MIRT005419 hsa-miR-125a-5p Immunofluorescence, qRT-PCR, Western blot 19881956
MIRT006719 hsa-miR-125b-5p Luciferase reporter assay 22307404
MIRT006719 hsa-miR-125b-5p Luciferase reporter assay 22307404
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IBA 21873635
GO:0005515 Function Protein binding IPI 21044950
GO:0005634 Component Nucleus IBA 21873635
GO:0005634 Component Nucleus NAS 10446990
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612457 14350 ENSG00000179361
Protein
UniProt ID Q8IVW6
Protein name AT-rich interactive domain-containing protein 3B (ARID domain-containing protein 3B) (Bright and dead ringer protein) (Bright-like protein)
Protein function Transcription factor which may be involved in neuroblastoma growth and malignant transformation. Favors nuclear targeting of ARID3A.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01388 ARID 217 303 ARID/BRIGHT DNA binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in placenta, testis and leukocytes. Expressed in neuroblastoma. Present in K-562 erythrocytic leukemia cell line (at protein level). {ECO:0000269|PubMed:10446990, ECO:0000269|PubMed:16951138}.
Sequence
MEPLQQQQQQQQQQQKQPHLAPLQMDAREKQGQQMREAQFLYAQKLVTQPTLLSATAGRP
SGSTPLGPLARVPPTAAVAQVFERGNMNSEPEEEDGGLEDEDGDDEVAEVAEKETQAASK
YFHVQKVARQDPRVAPMSNLLPAPGLPPHGQQAKEDHTKDASKASPSVSTAGQPNWNLDE
QLKQNGGLAWSDDADGGRGREISRDFAKLYELDGDPERKEFLDDLFVFMQKRGTPINRIP
IMAKQILDLYMLYKLVTEKGGLVEIINKKIWREITKGLNLPTSITSAAFTLRTQYMKYLY
AYE
CEKKALSSPAELQAAIDGNRREGRRPSYSSSLFGYSPAAATAAAAAGAPALLSPPKI
RFPILGLGSSSGTNTSSPRISPATTLRKGDGAPVTTVPVPNRLAVPVTLASQQAGTRTAA
LEQLRERLESGEPAEKKASRLSEEEQRLVQQAFQRNFFSMARQLPMKIRINGRAEDRAEA
SAAALNLTTSSIGSINMSVDIDGTTYAGVLFAQKPVVHLITGSAPQSLGSSASSSSSSHC
SPSPTSSRGTPSAEPSTSWSL
Sequence length 561
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Endometriosis Endometriosis 28881265 ClinVar, GWAS
Cleft Lip With Or Without Cleft Palate Cleft Lip With Or Without Cleft Palate GWAS
Glioblastoma Glioblastoma CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587 GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 22307404, 33592583
Cleft Lip Associate 35191549
Cleft Palate Associate 35191549
Colorectal Neoplasms Associate 33142733
Fetal Growth Retardation Associate 31415216
Neoplasm Metastasis Inhibit 37071790
Neoplasms Associate 32061921, 37071790
Obesity Associate 33142733
Orofacial Cleft 1 Associate 35191549
Otofaciocervical Syndrome Associate 35191549