Gene Gene information from NCBI Gene database.
Entrez ID 10618
Gene name Trans-golgi network protein 2
Gene symbol TGOLN2
Synonyms (NCBI Gene)
TGN38TGN46TGN48TGN51TTGN2hTGN46hTGN48hTGN51
Chromosome 2
Chromosome location 2p11.2
Summary This gene encodes a type I integral membrane protein that is localized to the trans-Golgi network, a major sorting station for secretory and membrane proteins. The encoded protein cycles between early endosomes and the trans-Golgi network, and may play a
miRNA miRNA information provided by mirtarbase database.
1855
miRTarBase ID miRNA Experiments Reference
MIRT022565 hsa-miR-124-3p Microarray 18668037
MIRT025778 hsa-miR-7-5p Microarray 19073608
MIRT028198 hsa-miR-33a-5p Sequencing 20371350
MIRT051296 hsa-miR-16-5p CLASH 23622248
MIRT046476 hsa-miR-15b-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17474147, 25416956, 32814053
GO:0005654 Component Nucleoplasm IDA
GO:0005768 Component Endosome IBA
GO:0005788 Component Endoplasmic reticulum lumen TAS
GO:0005794 Component Golgi apparatus IDA 22797923, 27435297
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603062 15450 ENSG00000152291
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43493
Protein name Trans-Golgi network integral membrane protein 2 (Trans-Golgi network glycoprotein 46) (TGN38 homolog) (hTGN46) (Trans-Golgi network glycoprotein 48) (hTGN48) (Trans-Golgi network glycoprotein 51) (hTGN51) (Trans-Golgi network protein 2)
Protein function May be involved in regulating membrane traffic to and from trans-Golgi network.
PDB 6YAF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17818 KCT2 293 437 Family
Tissue specificity TISSUE SPECIFICITY: Isoform TGN46 is widely expressed. Isoform TGN51 is more abundant in fetal lung and kidney. Isoform TGN48 is barely expressed in embryonic kidney and promyelocytic cells.
Sequence
MRFVVALVLLNVAAAGAVPLLATESVKQEEAGVRPSAGNVSTHPSLSQRPGGSTKSHPEP
QTPKDSPSKSSAEAQTPEDTPNKSGAEAKTQKDSSNKSGAEAKTQKGSTSKSGSEAQTTK
DSTSKSHPELQTPKDSTGKSGAEAQTPEDSPNRSGAEAKTQKDSPSKSGSEAQTTKDVPN
KSGADGQTPKDGSSKSGAEDQTPKDVPNKSGAEKQTPKDGSNKSGAEEQGPIDGPSKSGA
EEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGE
ETDLISPPQEEVKSSEPTEDVEPKEAEDDDTGPEEGSPPKEEKEKMSGSASSENREGTLS
DSTGSEKDDLYPNGSGNGSAESSHFFAYLVTAAILVAVLYIAHHNKRKIIAFVLEGKRSK
VTRRPKASDYQRLDQKS
Sequence length 437
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Virion - Hepatitis viruses   Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Golgi Associated Vesicle Biogenesis
Retrograde transport at the Trans-Golgi-Network
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Post-translational protein phosphorylation