Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10599
Gene name	Solute carrier organic anion transporter family member 1B1
Gene symbol	SLCO1B1
Synonyms (NCBI Gene)	HBLRRLST-1LST1OATP-COATP1B1OATP2OATPCSLC21A6
Chromosome	12
Chromosome location	12p12.1
Summary	This gene encodes a liver-specific member of the organic anion transporter family. The encoded protein is a transmembrane receptor that mediates the sodium-independent uptake of numerous endogenous compounds including bilirubin, 17-beta-glucuronosyl estra

Show/Hide all (6)

SNP ID	Visualize variation	Clinical significance	Consequence
rs2306283	A>C,G,T	Conflicting-interpretations-of-pathogenicity, benign	Coding sequence variant, missense variant
rs4149015	G>A,C,T	Drug-response	Upstream transcript variant
rs4149056	T>C	Drug-response, pathogenic, other, benign	Coding sequence variant, missense variant
rs11045879	T>C	Drug-response	Intron variant
rs71581941	C>A,T	Pathogenic, uncertain-significance	Synonymous variant, stop gained, coding sequence variant
rs183501729	C>T	Pathogenic	Stop gained, coding sequence variant

Show/Hide all (24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018741	hsa-miR-335-5p	Microarray	18185580
MIRT030029	hsa-miR-26b-5p	Microarray	19088304
MIRT1369299	hsa-miR-1	CLIP-seq
MIRT1369300	hsa-miR-2053	CLIP-seq
MIRT1369301	hsa-miR-206	CLIP-seq
MIRT1369302	hsa-miR-3673	CLIP-seq
MIRT1369303	hsa-miR-3692	CLIP-seq
MIRT1369304	hsa-miR-4659a-3p	CLIP-seq
MIRT1369305	hsa-miR-4659b-3p	CLIP-seq
MIRT1369306	hsa-miR-4789-5p	CLIP-seq
MIRT1369307	hsa-miR-511	CLIP-seq
MIRT1369308	hsa-miR-569	CLIP-seq
MIRT1369309	hsa-miR-613	CLIP-seq
MIRT1369310	hsa-miR-944	CLIP-seq
MIRT2109673	hsa-miR-3201	CLIP-seq
MIRT2109674	hsa-miR-4753-3p	CLIP-seq
MIRT2109675	hsa-miR-4768-5p	CLIP-seq
MIRT2109676	hsa-miR-4791	CLIP-seq
MIRT2109677	hsa-miR-651	CLIP-seq
MIRT2109673	hsa-miR-3201	CLIP-seq
MIRT2109674	hsa-miR-4753-3p	CLIP-seq
MIRT2109675	hsa-miR-4768-5p	CLIP-seq
MIRT2109676	hsa-miR-4791	CLIP-seq
MIRT2109677	hsa-miR-651	CLIP-seq

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10358072
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	10873595, 19129463, 26383540
GO:0009925	Component	Basal plasma membrane	IDA	35307651
GO:0009925	Component	Basal plasma membrane	IEA
GO:0015125	Function	Bile acid transmembrane transporter activity	IBA
GO:0015125	Function	Bile acid transmembrane transporter activity	TAS
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IDA	10873595
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	IBA
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	TAS	10358072
GO:0015349	Function	Thyroid hormone transmembrane transporter activity	TAS
GO:0015711	Process	Organic anion transport	TAS	10358072
GO:0015721	Process	Bile acid and bile salt transport	IBA
GO:0015721	Process	Bile acid and bile salt transport	TAS
GO:0015732	Process	Prostaglandin transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	10358072
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0042167	Process	Heme catabolic process	TAS
GO:0043252	Process	Sodium-independent organic anion transport	IBA
GO:0043252	Process	Sodium-independent organic anion transport	TAS
GO:0055085	Process	Transmembrane transport	IEA
GO:0070327	Process	Thyroid hormone transport	IEA

MIM	HGNC	e!Ensembl
604843	10959	ENSG00000134538

Q9Y6L6

Protein name

Solute carrier organic anion transporter family member 1B1 (SLCO1B1) (Liver-specific organic anion transporter 1) (LST-1) (OATP-C) (Organic anion transporter SLC21A6) (Sodium-independent organic anion-transporting polypeptide 2) (OATP-2) (Solute carrier f

Protein function

Mediates the Na(+)-independent uptake of organic anions (PubMed:10358072, PubMed:15159445, PubMed:17412826). Shows broad substrate specificity, can transport both organic anions such as bile acid taurocholate (cholyltaurine) and conjugated stero

PDB

8HNB , 8HNC , 8HND , 8HNH , 8K6L , 8PHW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03137	OATP	29 → 621	Organic Anion Transporter Polypeptide (OATP) family	Family
PF07648	Kazal_2	460 → 506	Kazal-type serine protease inhibitor domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in liver, at the basolateral membranes of centrilobular hepatocytes (PubMed:10358072, PubMed:10601278, PubMed:10873595, PubMed:12196548, PubMed:22232210). Expressed in liver (at protein level) (PubMed:15159445). Expres

Sequence

MDQNQHLNKTAEAQPSENKKTRYCNGLKMFLAALSLSFIAKTLGAIIMKSSIIHIERRFE
ISSSLVGFIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCFIMGIGGVLTALPHFFMGY
YRYSKETNINSSENSTSTLSTCLINQILSLNRASPEIVGKGCLKESGSYMWIYVFMGNML
RGIGETPIVPLGLSYIDDFAKEGHSSLYLGILNAIAMIGPIIGFTLGSLFSKMYVDIGYV
DLSTIRITPTDSRWVGAWWLNFLVSGLFSIISSIPFFFLPQTPNKPQKERKASLSLHVLE
TNDEKDQTANLTNQGKNITKNVTGFFQSFKSILTNPLYVMFVLLTLLQVSSYIGAFTYVF
KYVEQQYGQPSSKANILLGVITIPIFASGMFLGGYIIKKFKLNTVGIAKFSCFTAVMSLS
FYLLYFFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGIT
YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAI
QVLNLFFSALGGTSHVMLIVKIVQPELKSLALGFHSMVIRALGGILAPIYFGALIDTTCI
KWSTNNCGTRGSCRTYNSTSFSRVYLGLSSMLRVSSLVLYIILIYAMKKKYQEKDINASE
NGSVMDEANLESLNKNKHFVPSAGADSETHC

Sequence length

691

Interactions

View interactions

	KEGG		Reactome
	Bile secretion Folate transport and metabolism		Recycling of bile acids and salts Heme degradation Defective SLCO1B1 causes hyperbilirubinemia, Rotor type (HBLRR) Transport of organic anions

183

Show/Hide Causal Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Hepatocellular carcinoma	Likely pathogenic	rs200994482	RCV005931062
Rotor syndrome	Likely pathogenic; Pathogenic	rs200994482, rs71581941, rs183501729	RCV005230485 RCV000023390 RCV000023392
See cases	Likely pathogenic	rs200994482	RCV003314488
SLCO1B1-related disorder	Pathogenic	rs71581941	RCV003914860

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
atorvastatin response - Metabolism/PK	drug response	rs4149056	RCV001787819
atorvastatin response - Toxicity	drug response	rs4149056	RCV001787820
Cardiovascular phenotype	Uncertain significance; Likely benign	rs751041337, rs1341151780, rs2498180277, rs1941171798, rs1941623092, rs1240745256, rs780911188, rs568173893, rs2498261005, rs950082311, rs2498109273, rs2498171615, rs775651717, rs1940309529, rs1378329082 View all (10 more)	RCV002342839 RCV004134065 RCV004136687 RCV004157240 RCV004157241 RCV004178150 RCV004171707 RCV004204667 RCV004243952 RCV004274594 RCV004280487 RCV004301830 RCV004302502 RCV004305955 RCV004318528 RCV004356142 RCV004350429 RCV004457114 RCV004457116 RCV004457117 RCV004457118 RCV004457119 RCV004457120 RCV004457121 RCV006351479
fluvastatin response - Metabolism/PK	drug response	rs4149056	RCV003227613
fluvastatin response - Toxicity	drug response	rs4149056	RCV003227614
Gilbert syndrome	Benign; drug response	rs2306283, rs4149056	RCV000999564 RCV000999565
hmg coa reductase inhibitors response - Toxicity	drug response	rs4149056	RCV001787333
lovastatin acid response - Metabolism/PK	drug response	rs4149056	RCV003227615
lovastatin response - Metabolism/PK	drug response	rs4149056	RCV003227616
lovastatin response - Toxicity	drug response	rs4149056	RCV003227617
Ovarian serous cystadenocarcinoma	Benign	rs12305884	RCV005919394
pitavastatin response - Metabolism/PK	drug response	rs4149056	RCV003227618
pravastatin response - Toxicity	drug response	rs4149056	RCV003227619
rosuvastatin response - Metabolism/PK	drug response	rs4149056	RCV001787324
rosuvastatin response - Toxicity	drug response	rs4149056	RCV003227620
simvastatin acid response - Metabolism/PK	drug response	rs4149056	RCV000660832
simvastatin response - Metabolism/PK	drug response	rs4149056	RCV003227621
simvastatin response - Toxicity	drug response	rs4149056	RCV001787325

Show/Hide Text Mining Associations (87)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acute Disease	Associate	24712521
Adrenocortical Carcinoma	Associate	32607875
Amenorrhea	Associate	27234217
Anemia Sickle Cell	Associate	26146896
Anxiety	Associate	31181069
Arthritis Rheumatoid	Associate	31292326
Autism Spectrum Disorder	Associate	38287090
Bacterial Infections	Associate	34558822
Bile Duct Diseases	Associate	28084414
Breast Neoplasms	Associate	21457551, 25701109, 27234217, 28429243, 31190621, 32351149, 35501422
Carcinoma Hepatocellular	Associate	12695556, 21625523, 23352986
Carcinoma Hepatocellular	Inhibit	37680641
Cardiomyopathies	Associate	24324551
Cataract	Associate	37221222
Chagas Cardiomyopathy	Associate	24324551
Chemical and Drug Induced Liver Injury	Associate	24614281, 31240859
Cholangiocarcinoma	Associate	12695556
Cholelithiasis	Associate	19293444, 23577061, 26146896
Cleft Lip	Associate	36988826
Colorectal Neoplasms	Stimulate	21625523
Colorectal Neoplasms	Associate	21892003, 24143213, 30360603, 34599518
Coronary Artery Disease	Associate	34313350, 34385509
Coronary Disease	Associate	17439540, 34423691, 34563206
Cough	Associate	26607661
Depressive Disorder	Associate	31181069
Diabetes Mellitus Type 2	Associate	21178985, 31957862, 36169244
Diarrhea	Associate	28397089
Disease	Associate	33752528
Disease Progression	Associate	30360603
Drug Related Side Effects and Adverse Reactions	Associate	19901119, 25224634, 30927276, 31181069
Dyslipidemias	Associate	34563206
Endometrial Neoplasms	Associate	40141105
Epileptic Syndromes	Associate	16722833
Esophageal and Gastric Varices	Associate	34558822
Fabry Disease	Associate	27825144
Fatty Liver Alcoholic	Associate	28097795
Fibrosis	Associate	27543206, 34558822
Gastrointestinal Diseases	Associate	21892003
Heart Diseases	Associate	29738412
Heart Failure	Associate	27602404, 30946364
Hernia Inguinal	Associate	26826613
HIV Infections	Associate	20078617, 21743379, 28718515, 30779340, 37101315
Hot Flashes	Associate	29738412
Hyperbilirubinemia	Associate	20514852, 24090270, 26146841, 31253110, 38065921
Hyperbilirubinemia Hereditary	Associate	33860121, 35240056, 36964102
Hyperbilirubinemia Neonatal	Associate	24090270, 26146841, 31253110, 35501760, 38279097
Hypercholesterolemia	Associate	31981411, 38254988
Hyperlipidemias	Associate	15548849, 20140004, 30336686, 34749751
Hyperlipoproteinemia Type II	Associate	26334272, 27595674
Hypertension	Associate	32891149
Hypoglycemia	Associate	36169244
hypoglycemic encephalopathy	Associate	36169244
Inflammation	Associate	26826613
Inflammatory Bowel Diseases	Associate	34423897
Jaundice	Associate	27249515
Kidney Diseases	Associate	30946364
Liver Cirrhosis	Associate	27543206
Liver Cirrhosis Alcoholic	Associate	27543206
Liver Failure	Associate	31240859
Long QT Syndrome	Associate	29463526
Muscular Diseases	Associate	15681900, 18650507, 19833260, 21178985, 21360500, 21992719, 22617227, 23471819, 23858814, 24918167, 25224634, 26750564, 27539103, 27595674, 28350522 View all (13 more)
Musculoskeletal Diseases	Associate	35152405
Myalgia	Associate	36804920
Myocardial Infarction	Associate	25916517
Myositis	Associate	28771594
Myotoxicity	Associate	27539103, 29950617, 34114646
Nausea	Associate	33794950, 34423897
Neoplasm Residual	Associate	28525903
Neoplasms	Inhibit	21383546
Neoplasms	Associate	24614281
Neutropenia	Associate	25869015, 28397089, 30927276, 33752528
Pain	Associate	31957862
Pierre Robin syndrome with fetal chondrodysplasia	Associate	16722833
Renal Insufficiency	Associate	37239884
Renal Insufficiency Chronic	Associate	38308569
Rhabdomyolysis	Associate	31640597
Sarcoma Ewing	Inhibit	37731501
Scleroderma Systemic	Associate	37239884
Sexual Dysfunction Physiological	Associate	30360603
Signs and Symptoms Digestive	Associate	27825144
Sleep Initiation and Maintenance Disorders	Associate	29738412
Stomach Diseases	Associate	31727004
Stomatitis	Associate	23652803
Sweat Gland Diseases	Associate	29738412
Tetralogy of Fallot	Associate	33569925
Tuberculosis	Associate	25116663, 30779340
Tuberculosis Pulmonary	Associate	29463526

SLCO1B1 (solute carrier organic anion transporter family member 1B1)