SCGN (secretagogin, EF-hand calcium binding protein)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 10590
Gene name Secretagogin, EF-hand calcium binding protein
Gene symbol SCGN
Synonyms (NCBI Gene)
CALBLDJ501N12.8SECRETSEGNsetagin
Chromosome 6
Chromosome location 6p22.2
Summary The encoded protein is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation. [provided by RefSeq,
miRNA miRNA information provided by mirtarbase database.
4
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (4)
miRTarBase ID miRNA Experiments Reference
MIRT2321926 hsa-miR-3942-3p CLIP-seq
MIRT2321927 hsa-miR-4494 CLIP-seq
MIRT2321928 hsa-miR-4666-3p CLIP-seq
MIRT2321929 hsa-miR-499a-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (16)
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005509 Function Calcium ion binding NAS 10811645
GO:0005515 Function Protein binding IPI 16189514, 32296183, 33961781
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
609202 16941 ENSG00000079689
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O76038
Protein name Secretagogin
PDB 8BAV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00036 EF-hand_1 109 → 137 EF hand Domain
PF13202 EF-hand_5 156 → 179 EF hand Domain
Tissue specificity TISSUE SPECIFICITY: Expressed at high levels in the pancreatic islets of Langerhans and to a much lesser extent in the gastrointestinal tract (stomach, small intestine and colon), the adrenal medulla and cortex and the thyroid C-cells. In the brain, the e
Sequence 
MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLH
KVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDAD
SSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILAL
QENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGV
DLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP
Sequence length 276
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
SCGN-related disorder Likely benign; Benign rs143719979, rs60502981 RCV003952151
RCV003910487
Show/Hide Text Mining Associations (14)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 30342273
Carcinoma Hepatocellular Inhibit 35034536
Carcinoma Neuroendocrine Associate 39794740
Carcinoma Renal Cell Associate 39664565
Carcinoma Small Cell Associate 25226615
Colorectal Neoplasms Associate 35114976
Diabetes Mellitus Type 2 Associate 36789686
Hepatitis B Associate 39237981
Hepatitis C Associate 39766770
Neoplasm Metastasis Inhibit 39664565