SCGN (secretagogin, EF-hand calcium binding protein)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10590
Gene name Gene Name - the full gene name approved by the HGNC.
Secretagogin, EF-hand calcium binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SCGN
Synonyms (NCBI Gene) Gene synonyms aliases
CALBL, DJ501N12.8, SECRET, SEGN, setagin
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.2
Summary Summary of gene provided in NCBI Entrez Gene.
The encoded protein is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation. [provided by RefSeq,
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(4)
miRTarBase ID miRNA Experiments Reference
MIRT2321926 hsa-miR-3942-3p CLIP-seq
MIRT2321927 hsa-miR-4494 CLIP-seq
MIRT2321928 hsa-miR-4666-3p CLIP-seq
MIRT2321929 hsa-miR-499a-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(16)
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005509 Function Calcium ion binding NAS 10811645
GO:0005515 Function Protein binding IPI 16189514, 32296183, 33961781
GO:0005576 Component Extracellular region IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
609202 16941 ENSG00000079689
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID O76038
Protein name Secretagogin
PDB 8BAV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00036 EF-hand_1 109 → 137 EF hand Domain
PF13202 EF-hand_5 156 → 179 EF hand Domain
Tissue specificity TISSUE SPECIFICITY: Expressed at high levels in the pancreatic islets of Langerhans and to a much lesser extent in the gastrointestinal tract (stomach, small intestine and colon), the adrenal medulla and cortex and the thyroid C-cells. In the brain, the e
Sequence 
MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLH
KVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDAD
SSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILAL
QENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGV
DLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP
Sequence length 276
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (4)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer N/A N/A GWAS
Dental caries Dental caries N/A N/A GWAS
Neuroticism Neuroticism N/A N/A GWAS
Psoriasis Psoriasis N/A N/A GWAS
Show/Hide Text Mining Associations (14)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 30342273
Carcinoma Hepatocellular Inhibit 35034536
Carcinoma Neuroendocrine Associate 39794740
Carcinoma Renal Cell Associate 39664565
Carcinoma Small Cell Associate 25226615
Colorectal Neoplasms Associate 35114976
Diabetes Mellitus Type 2 Associate 36789686
Hepatitis B Associate 39237981
Hepatitis C Associate 39766770
Neoplasm Metastasis Inhibit 39664565