Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10589
Gene name Gene Name - the full gene name approved by the HGNC.	DR1 associated protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DRAP1
Synonyms (NCBI Gene) Gene synonyms aliases	NC2-alpha
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.1
Summary Summary of gene provided in NCBI Entrez Gene.	Transcriptional repression is a general mechanism for regulating transcriptional initiation in organisms ranging from yeast to humans. Accurate initiation of transcription from eukaryotic protein-encoding genes requires the assembly of a large multiprote

Show/Hide all(3)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020517	hsa-miR-155-5p	Proteomics	18668040
MIRT023515	hsa-miR-1-3p	Proteomics	18668040
MIRT038135	hsa-miR-423-5p	CLASH	23622248

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA	21873635
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	8670811
GO:0001046	Function	Core promoter sequence-specific DNA binding	IBA	21873635
GO:0001091	Function	RNA polymerase II general transcription initiation factor binding	IDA	8608938
GO:0001091	Function	RNA polymerase II general transcription initiation factor binding	IPI	8670811
GO:0003677	Function	DNA binding	IDA	8670811
GO:0003713	Function	Transcription coactivator activity	IBA	21873635
GO:0003714	Function	Transcription corepressor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	16189514, 16713569, 18692475, 21516116, 25416956, 27107012, 29997244, 31467278, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0006355	Process	Regulation of transcription, DNA-templated	IBA	21873635
GO:0006366	Process	Transcription by RNA polymerase II	IBA	21873635
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IBA	21873635
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IDA	8670811
GO:0017025	Function	TBP-class protein binding	IPI	8670811
GO:0017054	Component	Negative cofactor 2 complex	IBA	21873635
GO:0042802	Function	Identical protein binding	IPI	25416956, 27107012
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA	21873635
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	8670811

MIM	HGNC	e!Ensembl
602289	3019	ENSG00000175550

Protein

UniProt ID

Q14919

Protein name

Dr1-associated corepressor (Dr1-associated protein 1) (Negative cofactor 2-alpha) (NC2-alpha)

Protein function

The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the

PDB

1JFI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00808	CBFD_NFYB_HMF	10 → 74	Histone-like transcription factor (CBF/NF-Y) and archaeal histone	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Highly expressed in adult testis, heart, skeletal muscle, pancreas and brain, and in fetal brain, liver and kidney. {ECO:0000269|PubMed:8608938, ECO:0000269|PubMed:8670811}.

Sequence

MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSR
NAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRK
NGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFA
STLPLPPAPPGPSAPDEEDEEDYDS

Sequence length

205

Interactions

View interactions

	Reactome
			Signaling by NODAL Signaling by Activin

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340 View all (64 more)	22535842

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Evidence	Source
Unknown
Multiple Sclerosis	Multiple Sclerosis		GWAS
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients	GWAS, CBGDA

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	34493366
Carcinoma Renal Cell	Associate	35812454
Hypoxia	Stimulate	12477712
Hypoxia Brain	Associate	12477712
Pulmonary Disease Chronic Obstructive	Associate	34588774
Sveinsson Chorioretinal Atrophy	Stimulate	34493366

DRAP1 (DR1 associated protein 1)