DRAP1 (DR1 associated protein 1)

Gene

• Entrez ID: 10589
• Gene name: DR1 associated protein 1
• Gene symbol: DRAP1
• Synonyms (NCBI Gene): NC2-alpha
• Chromosome: 11
• Chromosome location: 11q13.1
• Summary: Transcriptional repression is a general mechanism for regulating transcriptional initiation in organisms ranging from yeast to humans. Accurate initiation of transcription from eukaryotic protein-encoding genes requires the assembly of a large multiprote

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020517	hsa-miR-155-5p	Proteomics	18668040
MIRT023515	hsa-miR-1-3p	Proteomics	18668040
MIRT038135	hsa-miR-423-5p	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	8670811
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	8608938
GO:0001046	Function	Core promoter sequence-specific DNA binding	IBA
GO:0001091	Function	RNA polymerase II general transcription initiation factor binding	IDA	8608938
GO:0001091	Function	RNA polymerase II general transcription initiation factor binding	IPI	8670811
GO:0003677	Function	DNA binding	IDA	8670811
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 16713569, 18692475, 21516116, 25416956, 27107012, 29997244, 31467278, 31515488, 32296183, 32814053, 33961781, 34819669, 37398436
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IBA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IBA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IDA	8670811
GO:0017025	Function	TBP-class protein binding	IPI	8670811
GO:0017054	Component	Negative cofactor 2 complex	IBA
GO:0042802	Function	Identical protein binding	IPI	25416956, 27107012
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	8670811

Other IDs

• MIM: 602289
• HGNC: 3019
• e!Ensembl: ENSG00000175550

Protein

• UniProt ID: Q14919
• Protein name: Dr1-associated corepressor (Dr1-associated protein 1) (Negative cofactor 2-alpha) (NC2-alpha)
• Protein function: The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the
• PDB: 1JFI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00808	CBFD_NFYB_HMF	10 → 74	Histone-like transcription factor (CBF/NF-Y) and archaeal histone	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Highly expressed in adult testis, heart, skeletal muscle, pancreas and brain, and in fetal brain, liver and kidney. {ECO:0000269|PubMed:8608938, ECO:0000269|PubMed:8670811}.
• Sequence:

  MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSR
  NAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRK
  NGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFA
  STLPLPPAPPGPSAPDEEDEEDYDS

• Sequence length: 205

Pathways

Reactome:

Signaling by NODAL
Signaling by Activin