Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10563
Gene name Gene Name - the full gene name approved by the HGNC.
C-X-C motif chemokine ligand 13
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CXCL13
Synonyms (NCBI Gene) Gene synonyms aliases
ANGIE, ANGIE2, BCA-1, BCA1, BLC, BLR1L, SCYB13
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q21.1
Summary Summary of gene provided in NCBI Entrez Gene.
B lymphocyte chemoattractant, independently cloned and named Angie, is an antimicrobial peptide and CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer`s patches. It preferentially promotes the migration of B lymphocyte
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT028916 hsa-miR-26b-5p Microarray 19088304
MIRT756107 hsa-miR-186-5p Luciferase reporter assay, Western blotting, qRT-PCR 35251568
MIRT917940 hsa-miR-1304 CLIP-seq
MIRT917941 hsa-miR-3671 CLIP-seq
MIRT917942 hsa-miR-498 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002467 Process Germinal center formation NAS 16543475
GO:0002518 Process Lymphocyte chemotaxis across high endothelial venule ISS
GO:0002544 Process Chronic inflammatory response NAS 15284119
GO:0002920 Process Regulation of humoral immune response NAS 16531331
GO:0005125 Function Cytokine activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605149 10639 ENSG00000156234
Protein
UniProt ID O43927
Protein name C-X-C motif chemokine 13 (Angie) (B cell-attracting chemokine 1) (BCA-1) (B lymphocyte chemoattractant) (CXC chemokine BLC) (Small-inducible cytokine B13)
Protein function Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.
PDB 5CBA , 5CBE , 6VGJ , 7JNY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 31 91 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Tissue specificity TISSUE SPECIFICITY: Highest levels in liver, followed by spleen, lymph node, appendix and stomach. Low levels in salivary gland, mammary gland and fetal spleen.
Sequence
MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGC
PRKEIIVWKKNKSIVCVDPQAEWIQRMMEVL
RKRSSSTLPVPVFKRKIP
Sequence length 109
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
  Chemokine receptors bind chemokines
G alpha (i) signalling events
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Rheumatoid arthritis Rheumatoid arthritis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Spontaneous Associate 36096448
Adenocarcinoma Stimulate 32073741
Adenocarcinoma Associate 32509861
Adenocarcinoma of Lung Associate 32549766, 35140113, 35844446, 36453453
Allergic Fungal Sinusitis Associate 19153309
Allergic Fungal Sinusitis Stimulate 22508623
Alzheimer Disease Stimulate 33803478
Anti N Methyl D Aspartate Receptor Encephalitis Stimulate 25436993, 30418472
Anti N Methyl D Aspartate Receptor Encephalitis Associate 36389787
Aortic Aneurysm Abdominal Associate 40775512