CXCL13 (C-X-C motif chemokine ligand 13)

Gene

• Entrez ID: 10563
• Gene name: C-X-C motif chemokine ligand 13
• Gene symbol: CXCL13
• Synonyms (NCBI Gene): ANGIE, ANGIE2, BCA-1, BCA1, BLC, BLR1L, SCYB13
• Chromosome: 4
• Chromosome location: 4q21.1
• Summary: B lymphocyte chemoattractant, independently cloned and named Angie, is an antimicrobial peptide and CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer`s patches. It preferentially promotes the migration of B lymphocyte

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028916	hsa-miR-26b-5p	Microarray	19088304
MIRT756107	hsa-miR-186-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35251568
MIRT917940	hsa-miR-1304	CLIP-seq
MIRT917941	hsa-miR-3671	CLIP-seq
MIRT917942	hsa-miR-498	CLIP-seq
MIRT917943	hsa-miR-607	CLIP-seq
MIRT1972097	hsa-miR-4707-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002467	Process	Germinal center formation	NAS	16543475
GO:0002518	Process	Lymphocyte chemotaxis across high endothelial venule	ISS
GO:0002544	Process	Chronic inflammatory response	NAS	15284119
GO:0002920	Process	Regulation of humoral immune response	NAS	16531331
GO:0005125	Function	Cytokine activity	IEA
GO:0005576	Component	Extracellular region	IDA	17562761, 17652619
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006952	Process	Defense response	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IC	11554781
GO:0006955	Process	Immune response	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	11554781
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IDA	11554781
GO:0007267	Process	Cell-cell signaling	IDA	11554781
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	11554781
GO:0008009	Function	Chemokine activity	IEA
GO:0008201	Function	Heparin binding	IDA	11708770
GO:0010820	Process	Positive regulation of T cell chemotaxis	IDA	11554781
GO:0017134	Function	Fibroblast growth factor binding	IDA	11708770
GO:0017134	Function	Fibroblast growth factor binding	IPI	11708770
GO:0030593	Process	Neutrophil chemotaxis	IBA
GO:0031640	Process	Killing of cells of another organism	IDA	12949249
GO:0031724	Function	CXCR5 chemokine receptor binding	IDA	9463416
GO:0031735	Function	CCR10 chemokine receptor binding	IDA	10706668
GO:0032487	Process	Regulation of Rap protein signal transduction	ISS
GO:0033625	Process	Positive regulation of integrin activation	ISS
GO:0033634	Process	Positive regulation of cell-cell adhesion mediated by integrin	ISS
GO:0035754	Process	B cell chemotaxis	IDA	9463416
GO:0035768	Process	Endothelial cell chemotaxis to fibroblast growth factor	IDA	11708770
GO:0042742	Process	Defense response to bacterium	IDA	17562761
GO:0045236	Function	CXCR chemokine receptor binding	IBA
GO:0045765	Process	Regulation of angiogenesis	NAS	11708770
GO:0048018	Function	Receptor ligand activity	IDA	11554781
GO:0048248	Function	CXCR3 chemokine receptor binding	IPI	11554781
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12949249
GO:0070098	Process	Chemokine-mediated signaling pathway	ISS	15972452
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA
GO:2000545	Process	Negative regulation of endothelial cell chemotaxis to fibroblast growth factor	IDA	11708770

Other IDs

• MIM: 605149
• HGNC: 10639
• e!Ensembl: ENSG00000156234

Protein

• UniProt ID: O43927
• Protein name: C-X-C motif chemokine 13 (Angie) (B cell-attracting chemokine 1) (BCA-1) (B lymphocyte chemoattractant) (CXC chemokine BLC) (Small-inducible cytokine B13)
• Protein function: Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.
• PDB: 5CBA, 5CBE, 6VGJ, 7JNY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	31 → 91	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highest levels in liver, followed by spleen, lymph node, appendix and stomach. Low levels in salivary gland, mammary gland and fetal spleen.
• Sequence:

  MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGC
  PRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP

• Sequence length: 109

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway

Reactome:

Chemokine receptors bind chemokines
G alpha (i) signalling events