Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10552
Gene name Gene Name - the full gene name approved by the HGNC.
Actin related protein 2/3 complex subunit 1A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ARPC1A
Synonyms (NCBI Gene) Gene synonyms aliases
Arc40, HEL-68, HEL-S-307, SOP2Hs, SOP2L
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes one of seven subunits of the human Arp2/3 protein complex. This subunit is a member of the SOP2 family of proteins and is most similar to the protein encoded by gene ARPC1B. The similarity between these two proteins suggests that they bo
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT046551 hsa-let-7i-5p CLASH 23622248
MIRT038032 hsa-miR-423-5p CLASH 23622248
MIRT799641 hsa-miR-1 CLIP-seq
MIRT799642 hsa-miR-1256 CLIP-seq
MIRT799643 hsa-miR-1276 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003779 Function Actin binding TAS 8978670
GO:0005634 Component Nucleus ISS
GO:0005829 Component Cytosol TAS
GO:0005885 Component Arp2/3 protein complex IBA 21873635
GO:0005885 Component Arp2/3 protein complex ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604220 703 ENSG00000241685
Protein
UniProt ID Q92747
Protein name Actin-related protein 2/3 complex subunit 1A (SOP2-like protein)
Protein function Probably functions as a component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. {ECO:0000305|Pub
PDB 6YW7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 42 80 WD domain, G-beta repeat Repeat
PF00400 WD40 132 170 WD domain, G-beta repeat Repeat
Sequence
MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWVKAHELKEHNGHITGIDW
APKSDRIVTCGADRNAYVWS
QKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLI
SVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKP
ASTPWGSKMPFGQLMSEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQVS
TLKTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDRGCLTFVSKLDIPKQSIQRNMSAM
ERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDGAMTIWDFKTL
ESSIQGLRIM
Sequence length 370
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Endocytosis
Tight junction
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Yersinia infection
  Regulation of actin dynamics for phagocytic cup formation
EPHB-mediated forward signaling
RHO GTPases Activate WASPs and WAVEs
Clathrin-mediated endocytosis
FCGR3A-mediated phagocytosis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Coronary syndrome Acute Coronary Syndrome 25935875 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35441736
Arthritis Rheumatoid Associate 28712091
Carcinoma Hepatocellular Stimulate 33960941
Carcinoma Non Small Cell Lung Associate 39867911
Lymphatic Metastasis Associate 32130760
Neoplasms Associate 32130760, 39867911