Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10551
Gene name Gene Name - the full gene name approved by the HGNC.
Anterior gradient 2, protein disulphide isomerase family member
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
AGR2
Synonyms (NCBI Gene) Gene synonyms aliases
AG-2, AG2, GOB-4, HAG-2, HEL-S-116, HPC8, PDIA17, RIFTD, XAG-2
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p21.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically ac
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004183 hsa-miR-197-3p Microarray 16822819
MIRT018401 hsa-miR-335-5p Microarray 18185580
MIRT737361 hsa-miR-342-3p Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry 32493835
MIRT772996 hsa-miR-194 CLIP-seq
MIRT772997 hsa-miR-2115 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
FOXA1 Unknown 16222343
FOXA2 Unknown 16222343
PA2G4 Activation 20048076
SPDEF Activation 19786015
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002162 Function Dystroglycan binding IBA
GO:0002162 Function Dystroglycan binding IDA 12592373
GO:0002162 Function Dystroglycan binding IEA
GO:0005154 Function Epidermal growth factor receptor binding IPI 25666625
GO:0005515 Function Protein binding IPI 12592373, 16189514, 19359471, 23220234, 25416956, 25910212, 32296183, 32814053, 34237462
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606358 328 ENSG00000106541
Protein
UniProt ID O95994
Protein name Anterior gradient protein 2 homolog (AG-2) (hAG-2) (HPC8) (Secreted cement gland protein XAG-2 homolog)
Protein function Required for MUC2 post-transcriptional synthesis and secretion. May play a role in the production of mucus by intestinal cells (By similarity). Proto-oncogene that may play a role in cell migration, cell differentiation and cell growth. Promotes
PDB 2LNS , 2LNT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13899 Thioredoxin_7 53 133 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed strongly in trachea, lung, stomach, colon, prostate and small intestine. Expressed weakly in pituitary gland, salivary gland, mammary gland, bladder, appendix, ovary, fetal lung, uterus, pancreas, kidney, fetal kidney, testis
Sequence
MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEE
ALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSP
DGQYVPRIMFVDP
SLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Sequence length 175
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cervical Cancer Cervical cancer N/A N/A GWAS
Diabetes Type 2 diabetes (dietary heme iron intake interaction) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Stimulate 21144054
Adenocarcinoma Associate 22605983, 22748473, 26894971, 33278424, 34911496, 35857928
Adenocarcinoma of Lung Associate 22430137, 33684161, 36595821
Barrett Esophagus Associate 21829465, 33491460
Biliary Tract Neoplasms Associate 25186196
Brain Neoplasms Associate 27100728
Breast Neoplasms Associate 16551856, 16598187, 20847343, 24167368, 25186196, 25956506, 26079208, 26733232, 30665445, 32593213, 34092584, 34567804, 34913074, 36405393, 37568077
Breast Neoplasms Stimulate 23029506
Calcinosis Cutis Associate 26876500, 30295739
Calcinosis Cutis Stimulate 36405393