Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10549
Gene name Gene Name - the full gene name approved by the HGNC.	Peroxiredoxin 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PRDX4
Synonyms (NCBI Gene) Gene synonyms aliases	AOE37-2, AOE372, HEL-S-97n, PRX-4
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xp22.11
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol wi

Show/Hide all(7)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046583	hsa-miR-222-3p	CLASH	23622248
MIRT041872	hsa-miR-484	CLASH	23622248
MIRT039796	hsa-miR-615-3p	CLASH	23622248
MIRT039796	hsa-miR-615-3p	CLASH	23622248
MIRT039210	hsa-miR-769-5p	CLASH	23622248
MIRT036386	hsa-miR-1229-3p	CLASH	23622248
MIRT052859	hsa-miR-3619-5p	CLASH	23622248

Show/Hide all(25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17644091, 21057456, 21988832, 25959826, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005783	Component	Endoplasmic reticulum	IBA	21873635
GO:0005790	Component	Smooth endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IBA	21873635
GO:0006979	Process	Response to oxidative stress	IBA	21873635
GO:0007252	Process	I-kappaB phosphorylation	TAS	9388242
GO:0007283	Process	Spermatogenesis	IEA
GO:0008379	Function	Thioredoxin peroxidase activity	IBA	21873635
GO:0008379	Function	Thioredoxin peroxidase activity	TAS	9388242
GO:0008584	Process	Male gonad development	IEA
GO:0018401	Process	Peptidyl-proline hydroxylation to 4-hydroxy-L-proline	IEA
GO:0022417	Process	Protein maturation by protein folding	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0033554	Process	Cellular response to stress	IBA	21873635
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042744	Process	Hydrogen peroxide catabolic process	IBA	21873635
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0045454	Process	Cell redox homeostasis	IBA	21873635
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0072593	Process	Reactive oxygen species metabolic process	IEA
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:2000255	Process	Negative regulation of male germ cell proliferation	IEA

MIM	HGNC	e!Ensembl
300927	17169	ENSG00000123131

Protein

UniProt ID

Q13162

Protein name

Peroxiredoxin-4 (EC 1.11.1.24) (Antioxidant enzyme AOE372) (AOE37-2) (Peroxiredoxin IV) (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Thioredoxin-dependent peroxiredoxin 4)

Protein function

Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrog

PDB

2PN8 , 3TJB , 3TJF , 3TJG , 3TJJ , 3TJK , 3TKP , 3TKQ , 3TKR , 3TKS , 4RQX , 5HQP , 8EKW , 8EKY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00578	AhpC-TSA	81 → 214	AhpC/TSA family	Domain
PF10417	1-cysPrx_C	234 → 263	C-terminal domain of 1-Cys peroxiredoxin	Domain

Sequence

MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVY
PGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDF
TFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDL
THQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDK
HGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

Sequence length

271

Interactions

View interactions

	Reactome
			Neutrophil degranulation

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Dermatitis	Dermatitis, Allergic Contact	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	16033404
Diffuse lymphoma	Diffuse Large B-Cell Lymphoma	rs121912651, rs121913289, rs121913293, rs878854402, rs869025340, rs1349928568, rs1569115687, rs121913291	16081686

Show/Hide Text Mining Associations (39)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Stimulate	26261544
Adenocarcinoma	Associate	30013444, 31588184
Adenocarcinoma of Lung	Associate	30013444, 31588184
Breast Neoplasms	Associate	40721644
Carcinoma Hepatocellular	Associate	25886747
Carcinoma Non Small Cell Lung	Associate	26261544
Carcinoma Renal Cell	Stimulate	36646187
Carcinoma Squamous Cell	Associate	26261544
Celiac Disease	Associate	20454521
Colorectal Neoplasms	Associate	37124724
Diabetes Mellitus Type 2	Stimulate	32457219
Diabetes Mellitus Type 2	Associate	36646187
Endometriosis	Associate	32436404
Glioblastoma	Stimulate	17233837
Glioblastoma	Associate	24728830
Hypothyroidism Congenital Nongoitrous 2	Stimulate	32436404
Hypoxia	Associate	32099002, 36646187
Leukemia	Associate	17656256
Leukemia Myeloid Acute	Associate	17656256
Leukemia Myeloid Acute	Inhibit	21283726
Leukemia Promyelocytic Acute	Inhibit	21283726
Lung Neoplasms	Associate	26261544
Muscular Dystrophy Duchenne	Associate	35008485
Neoplasm Metastasis	Inhibit	36822455
Neoplasm Metastasis	Stimulate	40721644
Neoplasms	Associate	17552011, 21487522, 30756364, 37124724
Neoplasms	Stimulate	21031435
Neoplasms	Inhibit	30013444
Pemphigus	Inhibit	33868574
Polycystic Ovary Syndrome	Inhibit	24098506
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	17656256
Prostatic Neoplasms	Associate	21031435
Pulmonary Disease Chronic Obstructive	Associate	32099002
Soft Tissue Injuries	Associate	20454521
Squamous Cell Carcinoma of Head and Neck	Associate	29802697
Stomach Neoplasms	Associate	32382548
Triple Negative Breast Neoplasms	Associate	37391754
Urinary Bladder Neoplasms	Associate	21487522
Uterine Diseases	Associate	32436404

PRDX4 (peroxiredoxin 4)