PRDX4 (peroxiredoxin 4)

Gene

• Entrez ID: 10549
• Gene name: Peroxiredoxin 4
• Gene symbol: PRDX4
• Synonyms (NCBI Gene): AOE37-2, AOE372, HEL-S-97n, PRX-4
• Chromosome: X
• Chromosome location: Xp22.11
• Summary: The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol wi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT046583	hsa-miR-222-3p	CLASH	23622248
MIRT041872	hsa-miR-484	CLASH	23622248
MIRT039796	hsa-miR-615-3p	CLASH	23622248
MIRT039796	hsa-miR-615-3p	CLASH	23622248
MIRT039210	hsa-miR-769-5p	CLASH	23622248
MIRT036386	hsa-miR-1229-3p	CLASH	23622248
MIRT052859	hsa-miR-3619-5p	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004601	Function	Peroxidase activity	IEA
GO:0005515	Function	Protein binding	IPI	17644091, 21057456, 21988832, 25959826, 32814053, 33961781
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0006979	Process	Response to oxidative stress	IBA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0007252	Process	I-kappaB phosphorylation	TAS	9388242
GO:0007283	Process	Spermatogenesis	IEA
GO:0008379	Function	Thioredoxin peroxidase activity	IBA
GO:0008379	Function	Thioredoxin peroxidase activity	TAS	9388242
GO:0008584	Process	Male gonad development	IEA
GO:0016209	Function	Antioxidant activity	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042744	Process	Hydrogen peroxide catabolic process	IBA
GO:0042802	Function	Identical protein binding	IEA
GO:0045454	Process	Cell redox homeostasis	IBA
GO:0045454	Process	Cell redox homeostasis	IEA
GO:0051604	Process	Protein maturation	IEA
GO:0051920	Function	Peroxiredoxin activity	IEA
GO:0060090	Function	Molecular adaptor activity	EXP	21916849
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0072593	Process	Reactive oxygen species metabolic process	IEA
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:0140313	Function	Molecular sequestering activity	IDA	21916849
GO:0140824	Function	Thioredoxin-dependent peroxiredoxin activity	IEA
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:2000255	Process	Negative regulation of male germ cell proliferation	IEA

Other IDs

• MIM: 300927
• HGNC: 17169
• e!Ensembl: ENSG00000123131

Protein

• UniProt ID: Q13162
• Protein name: Peroxiredoxin-4 (EC 1.11.1.24) (Antioxidant enzyme AOE372) (AOE37-2) (Peroxiredoxin IV) (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Thioredoxin-dependent peroxiredoxin 4)
• Protein function: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrog
• PDB: 2PN8, 3TJB, 3TJF, 3TJG, 3TJJ, 3TJK, 3TKP, 3TKQ, 3TKR, 3TKS, 4RQX, 5HQP, 8EKW, 8EKY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00578	AhpC-TSA	81 → 214	AhpC/TSA family	Domain
  PF10417	1-cysPrx_C	234 → 263	C-terminal domain of 1-Cys peroxiredoxin	Domain

• Sequence:

  MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVY
  PGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDF
  TFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDL
  THQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDK
  HGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

• Sequence length: 271

Pathways

Reactome:

Neutrophil degranulation

<