Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10538
Gene name Gene Name - the full gene name approved by the HGNC.	Basic leucine zipper ATF-like transcription factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BATF
Synonyms (NCBI Gene) Gene synonyms aliases	B-ATF, BATF1, SFA-2, SFA2
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q24.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein

Show/Hide all(2)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030216	hsa-miR-26b-5p	Microarray	19088304
MIRT735047	hsa-miR-155-3p	Microarray	32990751

Show/Hide all(53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001819	Process	Positive regulation of cytokine production	ISS
GO:0002320	Process	Lymphoid progenitor cell differentiation	IEA
GO:0002320	Process	Lymphoid progenitor cell differentiation	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	ISS
GO:0003700	Function	DNA-binding transcription factor activity	TAS	8630063
GO:0005515	Function	Protein binding	IPI	8954125, 16189514, 18330356, 18692475, 20102225, 23661758, 25416956, 27107012, 29997244, 31467278, 32296183, 32814053, 37398436
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	NAS	20102225, 23661758
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225, 23661758
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	ISS
GO:0030154	Process	Cell differentiation	IEA
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	IEA
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	ISS
GO:0042832	Process	Defense response to protozoan	IEA
GO:0042832	Process	Defense response to protozoan	ISS
GO:0043011	Process	Myeloid dendritic cell differentiation	IEA
GO:0043011	Process	Myeloid dendritic cell differentiation	ISS
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	ISS
GO:0045064	Process	T-helper 2 cell differentiation	IEA
GO:0045064	Process	T-helper 2 cell differentiation	ISS
GO:0045190	Process	Isotype switching	IEA
GO:0045190	Process	Isotype switching	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0060218	Process	Hematopoietic stem cell differentiation	IEA
GO:0060218	Process	Hematopoietic stem cell differentiation	ISS
GO:0072539	Process	T-helper 17 cell differentiation	IEA
GO:0072539	Process	T-helper 17 cell differentiation	ISS
GO:0072540	Process	T-helper 17 cell lineage commitment	IEA
GO:0072540	Process	T-helper 17 cell lineage commitment	ISS
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225, 23661758
GO:0140467	Process	Integrated stress response signaling	NAS	28566324
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000319	Process	Regulation of T-helper 17 cell differentiation	NAS	29234109

MIM	HGNC	e!Ensembl
612476	958	ENSG00000156127

Protein

UniProt ID

Q16520

Protein name

Basic leucine zipper transcriptional factor ATF-like (B-cell-activating transcription factor) (B-ATF) (SF-HT-activated gene 2 protein) (SFA-2)

Protein function

AP-1 family transcription factor that controls the differentiation of lineage-specific cells in the immune system: specifically mediates the differentiation of T-helper 17 cells (Th17), follicular T-helper cells (TfH), CD8(+) dendritic cells and

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00170	bZIP_1	24 → 87	bZIP transcription factor	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Expressed at highest levels in lung, and at lower levels in placenta, liver, kidney, spleen, and peripheral blood. Detected in SW480 colorectal cancer cell line and several hematopoietic tumor cell lines, including Raji Burkitt's lymph

Sequence

MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESED
LEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSS
PRFQP

Sequence length

125

Interactions

View interactions

	KEGG		Reactome
	PD-L1 expression and PD-1 checkpoint pathway in cancer		Interleukin-4 and Interleukin-13 signaling

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Dermatitis	Atopic dermatitis	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
Rheumatoid arthritis	Rheumatoid arthritis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (33)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
AIDS Dementia Complex	Associate	29128673
Arthritis Rheumatoid	Associate	24213554, 33004899
Atherosclerosis	Associate	36303246
Autoimmune Diseases	Associate	26986782, 28813651
Breast Neoplasms	Associate	34096887
Carcinoma Renal Cell	Associate	32733620, 39714755
Colorectal Neoplasms	Associate	33602893
Coronary Artery Disease	Inhibit	39680523
Coronary Disease	Inhibit	39680523
Dendritic Cell Sarcoma Follicular	Associate	29128673
Dermatitis Contact	Associate	33318199
Diabetes Mellitus Type 1	Associate	25170024
Drug Hypersensitivity	Associate	33318199
Endometrial Neoplasms	Associate	37352078
Hypophosphatemia Renal with Intracerebral Calcifications	Associate	29128673
Immune System Diseases	Associate	25170024
Inflammation	Associate	33976194
Leukemia Lymphocytic Chronic B Cell	Inhibit	37378949
Leukemia Myeloid Acute	Associate	40225861
Lupus Erythematosus Systemic	Associate	24213554
Lymphoma	Associate	32843547
Lymphoma B Cell	Associate	25207815
Lymphoma Large B Cell Diffuse	Associate	23424639, 24875472, 36982699
Lymphoma Large Cell Anaplastic	Associate	29588546
Lymphoma Primary Effusion	Associate	32843547
Neoplasm Metastasis	Associate	39714755
Neoplasms	Associate	31892342, 37012431, 40225861
Purpura Thrombocytopenic Idiopathic	Associate	27662073
Rupture	Associate	36303246
Scrub Typhus	Associate	33807835
Thyroid Cancer Papillary	Associate	33551988
Tuberculosis	Associate	31681314
Virus Diseases	Associate	29128673

BATF (basic leucine zipper ATF-like transcription factor)