Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10538
Gene name Gene Name - the full gene name approved by the HGNC.
Basic leucine zipper ATF-like transcription factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BATF
Synonyms (NCBI Gene) Gene synonyms aliases
B-ATF, BATF1, SFA-2, SFA2
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q24.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030216 hsa-miR-26b-5p Microarray 19088304
MIRT735047 hsa-miR-155-3p Microarray 32990751
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612476 958 ENSG00000156127
Protein
UniProt ID Q16520
Protein name Basic leucine zipper transcriptional factor ATF-like (B-cell-activating transcription factor) (B-ATF) (SF-HT-activated gene 2 protein) (SFA-2)
Protein function AP-1 family transcription factor that controls the differentiation of lineage-specific cells in the immune system: specifically mediates the differentiation of T-helper 17 cells (Th17), follicular T-helper cells (TfH), CD8(+) dendritic cells and
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00170 bZIP_1 24 87 bZIP transcription factor Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Expressed at highest levels in lung, and at lower levels in placenta, liver, kidney, spleen, and peripheral blood. Detected in SW480 colorectal cancer cell line and several hematopoietic tumor cell lines, including Raji Burkitt's lymph
Sequence
MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESED
LEKQNAALRKEIKQLTEELKYFTSVLN
SHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSS
PRFQP
Sequence length 125
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  PD-L1 expression and PD-1 checkpoint pathway in cancer   Interleukin-4 and Interleukin-13 signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dermatitis Atopic dermatitis N/A N/A GWAS
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Rheumatoid arthritis Rheumatoid arthritis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
AIDS Dementia Complex Associate 29128673
Arthritis Rheumatoid Associate 24213554, 33004899
Atherosclerosis Associate 36303246
Autoimmune Diseases Associate 26986782, 28813651
Breast Neoplasms Associate 34096887
Carcinoma Renal Cell Associate 32733620, 39714755
Colorectal Neoplasms Associate 33602893
Coronary Artery Disease Inhibit 39680523
Coronary Disease Inhibit 39680523
Dendritic Cell Sarcoma Follicular Associate 29128673