BATF (basic leucine zipper ATF-like transcription factor)

Gene

• Entrez ID: 10538
• Gene name: Basic leucine zipper ATF-like transcription factor
• Gene symbol: BATF
• Synonyms (NCBI Gene): B-ATF, BATF1, SFA-2, SFA2
• Chromosome: 14
• Chromosome location: 14q24.3
• Summary: The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030216	hsa-miR-26b-5p	Microarray	19088304
MIRT735047	hsa-miR-155-3p	Microarray	32990751

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001819	Process	Positive regulation of cytokine production	ISS
GO:0002320	Process	Lymphoid progenitor cell differentiation	IEA
GO:0002320	Process	Lymphoid progenitor cell differentiation	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	ISS
GO:0003700	Function	DNA-binding transcription factor activity	TAS	8630063
GO:0005515	Function	Protein binding	IPI	8954125, 16189514, 18330356, 18692475, 20102225, 23661758, 25416956, 27107012, 29997244, 31467278, 32296183, 32814053, 37398436
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	NAS	20102225, 23661758
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225, 23661758
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	ISS
GO:0030154	Process	Cell differentiation	IEA
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	IEA
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	ISS
GO:0042832	Process	Defense response to protozoan	IEA
GO:0042832	Process	Defense response to protozoan	ISS
GO:0043011	Process	Myeloid dendritic cell differentiation	IEA
GO:0043011	Process	Myeloid dendritic cell differentiation	ISS
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	ISS
GO:0045064	Process	T-helper 2 cell differentiation	IEA
GO:0045064	Process	T-helper 2 cell differentiation	ISS
GO:0045190	Process	Isotype switching	IEA
GO:0045190	Process	Isotype switching	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0060218	Process	Hematopoietic stem cell differentiation	IEA
GO:0060218	Process	Hematopoietic stem cell differentiation	ISS
GO:0072539	Process	T-helper 17 cell differentiation	IEA
GO:0072539	Process	T-helper 17 cell differentiation	ISS
GO:0072540	Process	T-helper 17 cell lineage commitment	IEA
GO:0072540	Process	T-helper 17 cell lineage commitment	ISS
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225, 23661758
GO:0140467	Process	Integrated stress response signaling	NAS	28566324
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000319	Process	Regulation of T-helper 17 cell differentiation	NAS	29234109

Other IDs

• MIM: 612476
• HGNC: 958
• e!Ensembl: ENSG00000156127

Protein

• UniProt ID: Q16520
• Protein name: Basic leucine zipper transcriptional factor ATF-like (B-cell-activating transcription factor) (B-ATF) (SF-HT-activated gene 2 protein) (SFA-2)
• Protein function: AP-1 family transcription factor that controls the differentiation of lineage-specific cells in the immune system: specifically mediates the differentiation of T-helper 17 cells (Th17), follicular T-helper cells (TfH), CD8(+) dendritic cells and
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00170	bZIP_1	24 → 87	bZIP transcription factor	Coiled-coil

• Tissue specificity: TISSUE SPECIFICITY: Expressed at highest levels in lung, and at lower levels in placenta, liver, kidney, spleen, and peripheral blood. Detected in SW480 colorectal cancer cell line and several hematopoietic tumor cell lines, including Raji Burkitt's lymph
• Sequence:

  MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESED
  LEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSS
  PRFQP

• Sequence length: 125

Pathways

KEGG:

PD-L1 expression and PD-1 checkpoint pathway in cancer

Reactome:

Interleukin-4 and Interleukin-13 signaling