Gene Gene information from NCBI Gene database.
Entrez ID 1052
Gene name CCAAT enhancer binding protein delta
Gene symbol CEBPD
Synonyms (NCBI Gene)
C/EBP-deltaCELFCRP3NF-IL6-beta
Chromosome 8
Chromosome location 8q11.21
Summary The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The encoded protein is important in the regulati
miRNA miRNA information provided by mirtarbase database.
215
miRTarBase ID miRNA Experiments Reference
MIRT027592 hsa-miR-98-5p Microarray 19088304
MIRT713044 hsa-miR-4999-3p HITS-CLIP 19536157
MIRT713043 hsa-miR-455-3p HITS-CLIP 19536157
MIRT713042 hsa-miR-6516-5p HITS-CLIP 19536157
MIRT713044 hsa-miR-4999-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
116898 1835 ENSG00000221869
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P49716
Protein name CCAAT/enhancer-binding protein delta (C/EBP delta) (Nuclear factor NF-IL6-beta) (NF-IL6-beta)
Protein function Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers (PubMed:16397300). Important transcription factor regulating the expression of
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07716 bZIP_2 190 243 Basic region leucine zipper Coiled-coil
Sequence
MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAID
FSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLK
REPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREK
SAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQL
TRD
LAGLRQFFKQLPSPPFLPAAGTADCR
Sequence length 269
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Interleukin-4 and Interleukin-13 signaling
HCMV Late Events