Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1052
Gene name Gene Name - the full gene name approved by the HGNC.	CCAAT enhancer binding protein delta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CEBPD
Synonyms (NCBI Gene) Gene synonyms aliases	C/EBP-delta, CELF, CRP3, NF-IL6-beta
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q11.21
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The encoded protein is important in the regulati

Show/Hide all(215)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027592	hsa-miR-98-5p	Microarray	19088304
MIRT713044	hsa-miR-4999-3p	HITS-CLIP	19536157
MIRT713043	hsa-miR-455-3p	HITS-CLIP	19536157
MIRT713042	hsa-miR-6516-5p	HITS-CLIP	19536157
MIRT713044	hsa-miR-4999-3p	HITS-CLIP	19536157
MIRT713043	hsa-miR-455-3p	HITS-CLIP	19536157
MIRT713042	hsa-miR-6516-5p	HITS-CLIP	19536157
MIRT643978	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT453703	hsa-miR-203b-5p	PAR-CLIP	23592263
MIRT453702	hsa-miR-6718-5p	PAR-CLIP	23592263
MIRT453701	hsa-miR-140-5p	PAR-CLIP	23592263
MIRT453700	hsa-miR-4645-5p	PAR-CLIP	23592263
MIRT453699	hsa-miR-4673	PAR-CLIP	23592263
MIRT453698	hsa-miR-6814-3p	PAR-CLIP	23592263
MIRT453697	hsa-miR-6872-5p	PAR-CLIP	23592263
MIRT453696	hsa-miR-3137	PAR-CLIP	23592263
MIRT453695	hsa-miR-103a-2-5p	PAR-CLIP	23592263
MIRT453694	hsa-miR-323a-5p	PAR-CLIP	23592263
MIRT453693	hsa-miR-876-3p	PAR-CLIP	23592263
MIRT453692	hsa-miR-4727-3p	PAR-CLIP	23592263
MIRT453691	hsa-miR-4460	PAR-CLIP	23592263
MIRT453690	hsa-miR-3591-5p	PAR-CLIP	23592263
MIRT453689	hsa-miR-4426	PAR-CLIP	23592263
MIRT453688	hsa-miR-4647	PAR-CLIP	23592263
MIRT453687	hsa-miR-4662b	PAR-CLIP	23592263
MIRT453686	hsa-miR-3668	PAR-CLIP	23592263
MIRT453684	hsa-miR-4709-5p	PAR-CLIP	23592263
MIRT453685	hsa-miR-4433a-3p	PAR-CLIP	23592263
MIRT453683	hsa-miR-421	PAR-CLIP	23592263
MIRT054423	hsa-miR-95-3p	qRT-PCR, Western blot, Luciferase reporter assay	26165303
MIRT713044	hsa-miR-4999-3p	HITS-CLIP	19536157
MIRT713043	hsa-miR-455-3p	HITS-CLIP	19536157
MIRT713042	hsa-miR-6516-5p	HITS-CLIP	19536157
MIRT713044	hsa-miR-4999-3p	HITS-CLIP	19536157
MIRT713043	hsa-miR-455-3p	HITS-CLIP	19536157
MIRT713042	hsa-miR-6516-5p	HITS-CLIP	19536157
MIRT643978	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT453703	hsa-miR-203b-5p	PAR-CLIP	23592263
MIRT453702	hsa-miR-6718-5p	PAR-CLIP	23592263
MIRT453701	hsa-miR-140-5p	PAR-CLIP	23592263
MIRT453700	hsa-miR-4645-5p	PAR-CLIP	23592263
MIRT453699	hsa-miR-4673	PAR-CLIP	23592263
MIRT453698	hsa-miR-6814-3p	PAR-CLIP	23592263
MIRT453697	hsa-miR-6872-5p	PAR-CLIP	23592263
MIRT453696	hsa-miR-3137	PAR-CLIP	23592263
MIRT453695	hsa-miR-103a-2-5p	PAR-CLIP	23592263
MIRT453694	hsa-miR-323a-5p	PAR-CLIP	23592263
MIRT453693	hsa-miR-876-3p	PAR-CLIP	23592263
MIRT453692	hsa-miR-4727-3p	PAR-CLIP	23592263
MIRT453691	hsa-miR-4460	PAR-CLIP	23592263
MIRT453690	hsa-miR-3591-5p	PAR-CLIP	23592263
MIRT453689	hsa-miR-4426	PAR-CLIP	23592263
MIRT453688	hsa-miR-4647	PAR-CLIP	23592263
MIRT453687	hsa-miR-4662b	PAR-CLIP	23592263
MIRT453686	hsa-miR-3668	PAR-CLIP	23592263
MIRT453684	hsa-miR-4709-5p	PAR-CLIP	23592263
MIRT453685	hsa-miR-4433a-3p	PAR-CLIP	23592263
MIRT453683	hsa-miR-421	PAR-CLIP	23592263
MIRT883307	hsa-let-7a	CLIP-seq
MIRT883308	hsa-let-7b	CLIP-seq
MIRT883309	hsa-let-7c	CLIP-seq
MIRT883310	hsa-let-7d	CLIP-seq
MIRT883311	hsa-let-7e	CLIP-seq
MIRT883312	hsa-let-7f	CLIP-seq
MIRT883313	hsa-let-7g	CLIP-seq
MIRT883314	hsa-let-7i	CLIP-seq
MIRT883315	hsa-miR-1184	CLIP-seq
MIRT883316	hsa-miR-1207-5p	CLIP-seq
MIRT883317	hsa-miR-1231	CLIP-seq
MIRT883318	hsa-miR-1238	CLIP-seq
MIRT883319	hsa-miR-1283	CLIP-seq
MIRT883320	hsa-miR-149	CLIP-seq
MIRT883321	hsa-miR-202	CLIP-seq
MIRT883322	hsa-miR-22	CLIP-seq
MIRT883323	hsa-miR-3064-5p	CLIP-seq
MIRT883324	hsa-miR-3115	CLIP-seq
MIRT883325	hsa-miR-3178	CLIP-seq
MIRT883326	hsa-miR-323-5p	CLIP-seq
MIRT883327	hsa-miR-338-5p	CLIP-seq
MIRT883328	hsa-miR-3545-5p	CLIP-seq
MIRT883329	hsa-miR-3615	CLIP-seq
MIRT883330	hsa-miR-4264	CLIP-seq
MIRT883331	hsa-miR-4288	CLIP-seq
MIRT883332	hsa-miR-4418	CLIP-seq
MIRT883333	hsa-miR-4436b-3p	CLIP-seq
MIRT883334	hsa-miR-4458	CLIP-seq
MIRT883335	hsa-miR-4500	CLIP-seq
MIRT883336	hsa-miR-4649-3p	CLIP-seq
MIRT883337	hsa-miR-4663	CLIP-seq
MIRT883338	hsa-miR-4685-5p	CLIP-seq
MIRT883339	hsa-miR-4711-5p	CLIP-seq
MIRT883340	hsa-miR-4738-3p	CLIP-seq
MIRT883341	hsa-miR-4763-3p	CLIP-seq
MIRT883342	hsa-miR-4766-5p	CLIP-seq
MIRT883343	hsa-miR-4768-5p	CLIP-seq
MIRT883344	hsa-miR-4794	CLIP-seq
MIRT883345	hsa-miR-509-3-5p	CLIP-seq
MIRT883346	hsa-miR-509-5p	CLIP-seq
MIRT883347	hsa-miR-520d-5p	CLIP-seq
MIRT883348	hsa-miR-524-5p	CLIP-seq
MIRT883349	hsa-miR-572	CLIP-seq
MIRT883350	hsa-miR-604	CLIP-seq
MIRT883351	hsa-miR-622	CLIP-seq
MIRT883352	hsa-miR-627	CLIP-seq
MIRT883353	hsa-miR-628-5p	CLIP-seq
MIRT883354	hsa-miR-632	CLIP-seq
MIRT883355	hsa-miR-647	CLIP-seq
MIRT883356	hsa-miR-760	CLIP-seq
MIRT883357	hsa-miR-924	CLIP-seq
MIRT883358	hsa-miR-941	CLIP-seq
MIRT883359	hsa-miR-942	CLIP-seq
MIRT883360	hsa-miR-98	CLIP-seq
MIRT883326	hsa-miR-323-5p	CLIP-seq
MIRT883328	hsa-miR-3545-5p	CLIP-seq
MIRT883329	hsa-miR-3615	CLIP-seq
MIRT883343	hsa-miR-4768-5p	CLIP-seq
MIRT883347	hsa-miR-520d-5p	CLIP-seq
MIRT883348	hsa-miR-524-5p	CLIP-seq
MIRT883359	hsa-miR-942	CLIP-seq
MIRT1961896	hsa-miR-105	CLIP-seq
MIRT883315	hsa-miR-1184	CLIP-seq
MIRT883316	hsa-miR-1207-5p	CLIP-seq
MIRT883317	hsa-miR-1231	CLIP-seq
MIRT883318	hsa-miR-1238	CLIP-seq
MIRT883319	hsa-miR-1283	CLIP-seq
MIRT883320	hsa-miR-149	CLIP-seq
MIRT883323	hsa-miR-3064-5p	CLIP-seq
MIRT883325	hsa-miR-3178	CLIP-seq
MIRT883327	hsa-miR-338-5p	CLIP-seq
MIRT1961897	hsa-miR-3671	CLIP-seq
MIRT883330	hsa-miR-4264	CLIP-seq
MIRT883331	hsa-miR-4288	CLIP-seq
MIRT883332	hsa-miR-4418	CLIP-seq
MIRT883333	hsa-miR-4436b-3p	CLIP-seq
MIRT883338	hsa-miR-4685-5p	CLIP-seq
MIRT883340	hsa-miR-4738-3p	CLIP-seq
MIRT883341	hsa-miR-4763-3p	CLIP-seq
MIRT883342	hsa-miR-4766-5p	CLIP-seq
MIRT883344	hsa-miR-4794	CLIP-seq
MIRT883345	hsa-miR-509-3-5p	CLIP-seq
MIRT883346	hsa-miR-509-5p	CLIP-seq
MIRT883347	hsa-miR-520d-5p	CLIP-seq
MIRT883348	hsa-miR-524-5p	CLIP-seq
MIRT883349	hsa-miR-572	CLIP-seq
MIRT1961898	hsa-miR-600	CLIP-seq
MIRT883350	hsa-miR-604	CLIP-seq
MIRT1961899	hsa-miR-607	CLIP-seq
MIRT883351	hsa-miR-622	CLIP-seq
MIRT883354	hsa-miR-632	CLIP-seq
MIRT883355	hsa-miR-647	CLIP-seq
MIRT883356	hsa-miR-760	CLIP-seq
MIRT883358	hsa-miR-941	CLIP-seq
MIRT883307	hsa-let-7a	CLIP-seq
MIRT883308	hsa-let-7b	CLIP-seq
MIRT883309	hsa-let-7c	CLIP-seq
MIRT883310	hsa-let-7d	CLIP-seq
MIRT883311	hsa-let-7e	CLIP-seq
MIRT883312	hsa-let-7f	CLIP-seq
MIRT883313	hsa-let-7g	CLIP-seq
MIRT883314	hsa-let-7i	CLIP-seq
MIRT883316	hsa-miR-1207-5p	CLIP-seq
MIRT883321	hsa-miR-202	CLIP-seq
MIRT883322	hsa-miR-22	CLIP-seq
MIRT883324	hsa-miR-3115	CLIP-seq
MIRT883325	hsa-miR-3178	CLIP-seq
MIRT883326	hsa-miR-323-5p	CLIP-seq
MIRT883328	hsa-miR-3545-5p	CLIP-seq
MIRT883329	hsa-miR-3615	CLIP-seq
MIRT883333	hsa-miR-4436b-3p	CLIP-seq
MIRT883334	hsa-miR-4458	CLIP-seq
MIRT883335	hsa-miR-4500	CLIP-seq
MIRT883336	hsa-miR-4649-3p	CLIP-seq
MIRT883338	hsa-miR-4685-5p	CLIP-seq
MIRT883339	hsa-miR-4711-5p	CLIP-seq
MIRT883341	hsa-miR-4763-3p	CLIP-seq
MIRT883343	hsa-miR-4768-5p	CLIP-seq
MIRT883359	hsa-miR-942	CLIP-seq
MIRT883360	hsa-miR-98	CLIP-seq
MIRT2427303	hsa-miR-1183	CLIP-seq
MIRT883317	hsa-miR-1231	CLIP-seq
MIRT883318	hsa-miR-1238	CLIP-seq
MIRT883319	hsa-miR-1283	CLIP-seq
MIRT2427304	hsa-miR-200b	CLIP-seq
MIRT2427305	hsa-miR-200c	CLIP-seq
MIRT883322	hsa-miR-22	CLIP-seq
MIRT2427306	hsa-miR-3163	CLIP-seq
MIRT883327	hsa-miR-338-5p	CLIP-seq
MIRT2427307	hsa-miR-3607-3p	CLIP-seq
MIRT2427308	hsa-miR-3609	CLIP-seq
MIRT883330	hsa-miR-4264	CLIP-seq
MIRT883331	hsa-miR-4288	CLIP-seq
MIRT2427309	hsa-miR-429	CLIP-seq
MIRT2427310	hsa-miR-4433	CLIP-seq
MIRT883339	hsa-miR-4711-5p	CLIP-seq
MIRT883342	hsa-miR-4766-5p	CLIP-seq
MIRT883347	hsa-miR-520d-5p	CLIP-seq
MIRT883348	hsa-miR-524-5p	CLIP-seq
MIRT2427311	hsa-miR-548ah	CLIP-seq
MIRT2427312	hsa-miR-548c-3p	CLIP-seq
MIRT2427313	hsa-miR-548t	CLIP-seq
MIRT883351	hsa-miR-622	CLIP-seq
MIRT883354	hsa-miR-632	CLIP-seq
MIRT2427314	hsa-miR-889	CLIP-seq
MIRT883315	hsa-miR-1184	CLIP-seq
MIRT883320	hsa-miR-149	CLIP-seq
MIRT883323	hsa-miR-3064-5p	CLIP-seq
MIRT883332	hsa-miR-4418	CLIP-seq
MIRT883340	hsa-miR-4738-3p	CLIP-seq
MIRT883344	hsa-miR-4794	CLIP-seq
MIRT883345	hsa-miR-509-3-5p	CLIP-seq
MIRT883346	hsa-miR-509-5p	CLIP-seq
MIRT883350	hsa-miR-604	CLIP-seq
MIRT883355	hsa-miR-647	CLIP-seq
MIRT883356	hsa-miR-760	CLIP-seq
MIRT883358	hsa-miR-941	CLIP-seq

Show/Hide all(32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	20102225, 20805509
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	20102225
GO:0005654	Component	Nucleoplasm	TAS
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225
GO:0006366	Process	Transcription by RNA polymerase II	TAS	8314590
GO:0042802	Function	Identical protein binding	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045595	Process	Regulation of cell differentiation	IBA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048839	Process	Inner ear development	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225
GO:0090575	Component	RNA polymerase II transcription regulator complex	NAS	20102225
GO:0140467	Process	Integrated stress response signaling	NAS	28566324
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
116898	1835	ENSG00000221869

Protein

UniProt ID

P49716

Protein name

CCAAT/enhancer-binding protein delta (C/EBP delta) (Nuclear factor NF-IL6-beta) (NF-IL6-beta)

Protein function

Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers (PubMed:16397300). Important transcription factor regulating the expression of

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07716	bZIP_2	190 → 243	Basic region leucine zipper	Coiled-coil

Sequence

MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAID
FSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLK
REPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREK
SAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQL
TRDLAGLRQFFKQLPSPPFLPAAGTADCR

Sequence length

269

Interactions

View interactions

	Reactome
			Interleukin-4 and Interleukin-13 signaling HCMV Late Events

CEBPD (CCAAT enhancer binding protein delta)