Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1052
Gene name Gene Name - the full gene name approved by the HGNC.
CCAAT enhancer binding protein delta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CEBPD
Synonyms (NCBI Gene) Gene synonyms aliases
C/EBP-delta, CELF, CRP3, NF-IL6-beta
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q11.21
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The encoded protein is important in the regulati
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT027592 hsa-miR-98-5p Microarray 19088304
MIRT713044 hsa-miR-4999-3p HITS-CLIP 19536157
MIRT713043 hsa-miR-455-3p HITS-CLIP 19536157
MIRT713042 hsa-miR-6516-5p HITS-CLIP 19536157
MIRT713044 hsa-miR-4999-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
116898 1835 ENSG00000221869
Protein
UniProt ID P49716
Protein name CCAAT/enhancer-binding protein delta (C/EBP delta) (Nuclear factor NF-IL6-beta) (NF-IL6-beta)
Protein function Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers (PubMed:16397300). Important transcription factor regulating the expression of
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07716 bZIP_2 190 243 Basic region leucine zipper Coiled-coil
Sequence
MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAID
FSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLK
REPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREK
SAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQL
TRD
LAGLRQFFKQLPSPPFLPAAGTADCR
Sequence length 269
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Interleukin-4 and Interleukin-13 signaling
HCMV Late Events
<