Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10480
Gene name Gene Name - the full gene name approved by the HGNC.
Eukaryotic translation initiation factor 3 subunit M
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EIF3M
Synonyms (NCBI Gene) Gene synonyms aliases
B5, GA17, PCID1, TANGO7, hfl-B5
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that is part of the eurkaryotic translation initiation factor 3 complete (eIF-3) required for protein synthesis. Elevated levels of the encoded protein are present in cancer cell lines. Inactivation of the encoded protein has b
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022389 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT031556 hsa-miR-16-5p Proteomics 18668040
MIRT048348 hsa-miR-106a-5p CLASH 23622248
MIRT043004 hsa-miR-324-3p CLASH 23622248
MIRT041230 hsa-miR-193b-3p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
ZIC1 Activation 20713527
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001732 Process Formation of cytoplasmic translation initiation complex IEA
GO:0001732 Process Formation of cytoplasmic translation initiation complex NAS 16920360
GO:0002183 Process Cytoplasmic translational initiation IBA
GO:0002183 Process Cytoplasmic translational initiation IEA
GO:0003743 Function Translation initiation factor activity IC 17322308, 18599441
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609641 24460 ENSG00000149100
Protein
UniProt ID Q7L2H7
Protein name Eukaryotic translation initiation factor 3 subunit M (eIF3m) (Fetal lung protein B5) (hFL-B5) (PCI domain-containing protein 1)
Protein function Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17403899, PubMed:25849773, PubMed:27462815). The eIF-3 complex associates with the 40
PDB 3J8B , 3J8C , 6FEC , 6YBD , 6ZMW , 6ZON , 6ZP4 , 6ZVJ , 7A09 , 7QP6 , 7QP7 , 8OZ0 , 8PJ1 , 8PJ2 , 8PJ3 , 8PJ4 , 8PJ5 , 8PJ6 , 8PPL , 8RG0 , 8XXN , 9BLN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01399 PCI 235 336 PCI domain Domain
PF18005 eIF3m_C_helix 340 368 eIF3 subunit M, C-terminal helix Domain
Tissue specificity TISSUE SPECIFICITY: Broadly expressed. {ECO:0000269|PubMed:15919898}.
Sequence
MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDV
ESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVR
YTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDA
ASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDL
LTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQE
LQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSH
STHRTFGKQQWQQLYDTLNAWKQN
LNKVKNSL
LSLSDT
Sequence length 374
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    L13a-mediated translational silencing of Ceruloplasmin expression
Translation initiation complex formation
Formation of a pool of free 40S subunits
Formation of the ternary complex, and subsequently, the 43S complex
Ribosomal scanning and start codon recognition
GTP hydrolysis and joining of the 60S ribosomal subunit
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Uterine Fibroids Uterine fibroids N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Hypertension Associate 32664164
Pre Eclampsia Associate 36421809
Ventricular Remodeling Stimulate 32664164