EIF3M (eukaryotic translation initiation factor 3 subunit M)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID 10480
Gene name Eukaryotic translation initiation factor 3 subunit M
Gene symbol EIF3M
Synonyms (NCBI Gene)
B5GA17PCID1TANGO7hfl-B5
Chromosome 11
Chromosome location 11p13
Summary This gene encodes a protein that is part of the eurkaryotic translation initiation factor 3 complete (eIF-3) required for protein synthesis. Elevated levels of the encoded protein are present in cancer cell lines. Inactivation of the encoded protein has b
miRNA miRNA information provided by mirtarbase database.
13
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (13)
miRTarBase ID miRNA Experiments Reference
MIRT022389 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT031556 hsa-miR-16-5p Proteomics 18668040
MIRT048348 hsa-miR-106a-5p CLASH 23622248
MIRT043004 hsa-miR-324-3p CLASH 23622248
MIRT041230 hsa-miR-193b-3p CLASH 23622248
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (1)
Transcription factor Regulation Reference
ZIC1 Activation 20713527
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (23)
GO ID Ontology Definition Evidence Reference
GO:0001732 Process Formation of cytoplasmic translation initiation complex IEA
GO:0001732 Process Formation of cytoplasmic translation initiation complex NAS 16920360
GO:0002183 Process Cytoplasmic translational initiation IBA
GO:0002183 Process Cytoplasmic translational initiation IEA
GO:0003743 Function Translation initiation factor activity IC 17322308, 18599441
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
609641 24460 ENSG00000149100
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7L2H7
Protein name Eukaryotic translation initiation factor 3 subunit M (eIF3m) (Fetal lung protein B5) (hFL-B5) (PCI domain-containing protein 1)
Protein function Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17403899, PubMed:25849773, PubMed:27462815). The eIF-3 complex associates with the 40
PDB 3J8B , 3J8C , 6FEC , 6YBD , 6ZMW , 6ZON , 6ZP4 , 6ZVJ , 7A09 , 7QP6 , 7QP7 , 8OZ0 , 8PJ1 , 8PJ2 , 8PJ3 , 8PJ4 , 8PJ5 , 8PJ6 , 8PPL , 8RG0 , 8XXN , 9BLN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01399 PCI 235 → 336 PCI domain Domain
PF18005 eIF3m_C_helix 340 → 368 eIF3 subunit M, C-terminal helix Domain
Tissue specificity TISSUE SPECIFICITY: Broadly expressed. {ECO:0000269|PubMed:15919898}.
Sequence 
MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDV
ESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVR
YTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDA
ASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDL
LTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQE
LQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQN
LNKVKNSLLSLSDT
Sequence length 374
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
  Reactome
    L13a-mediated translational silencing of Ceruloplasmin expression
Translation initiation complex formation
Formation of a pool of free 40S subunits
Formation of the ternary complex, and subsequently, the 43S complex
Ribosomal scanning and start codon recognition
GTP hydrolysis and joining of the 60S ribosomal subunit