CLEC10A (C-type lectin domain containing 10A)

Gene

• Entrez ID: 10462
• Gene name: C-type lectin domain containing 10A
• Gene symbol: CLEC10A
• Synonyms (NCBI Gene): CD301, CLECSF13, CLECSF14, DC-ASGPR, HML, HML2, MGL
• Chromosome: 17
• Chromosome location: 17p13.1
• Summary: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32766577, 32915505, 33961781, 34015061
GO:0005537	Function	D-mannose binding	IBA
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8598452
GO:0006897	Process	Endocytosis	IEA
GO:0006955	Process	Immune response	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030246	Function	Carbohydrate binding	TAS	8598452
GO:0031901	Component	Early endosome membrane	IEA
GO:0038187	Function	Pattern recognition receptor activity	IBA
GO:0042806	Function	Fucose binding	IBA
GO:0045087	Process	Innate immune response	IEA

Other IDs

• MIM: 605999
• HGNC: 16916
• e!Ensembl: ENSG00000132514

Protein

• UniProt ID: Q8IUN9
• Protein name: C-type lectin domain family 10 member A (C-type lectin superfamily member 14) (DC-asialoglycoprotein receptor) (DC-ASGPR) (Macrophage galactose-type lectin) (MGL) (Macrophage lectin 2) (CD antigen CD301)
• Protein function: C-type lectin receptor involved in recognition of N-acetylgalactosamine (GalNAc)-terminated glycans by myeloid antigen presenting cells (APCs) (PubMed:15802303, PubMed:16998493, PubMed:17616966, PubMed:22213806, PubMed:33724805, PubMed:8598452).
• PDB: 6PUV, 6PY1, 6W12, 6XIY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03954	Lectin_N	12 → 131		Family
  PF00059	Lectin_C	198 → 306	Lectin C-type domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in myeloid antigen presenting cells in lymph nodes and skin (at protein level). Expressed in dermal dendritic cells (at protein level). {ECO:0000269|PubMed:16998493, ECO:0000269|PubMed:22213806}.
• Sequence:

  MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGF
  QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVS
  ELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTC
  CPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMG
  LSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPY
  HWVCEAGLGQTSQESH

• Sequence length: 316

Pathways

Reactome:

Dectin-2 family