Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10445
Gene name Gene Name - the full gene name approved by the HGNC.	Microspherule protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MCRS1
Synonyms (NCBI Gene) Gene synonyms aliases	ICP22BP, INO80Q, MCRS2, MSP58, P78
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q13.12

Show/Hide all(45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044730	hsa-miR-320a	CLASH	23622248
MIRT043001	hsa-miR-324-3p	CLASH	23622248
MIRT041247	hsa-miR-193b-3p	CLASH	23622248
MIRT041247	hsa-miR-193b-3p	CLASH	23622248
MIRT739828	hsa-miR-3194-5p	CLIP-seq
MIRT739830	hsa-miR-4719	CLIP-seq
MIRT739829	hsa-miR-4753-5p	CLIP-seq
MIRT739831	hsa-miR-513b	CLIP-seq
MIRT1138054	hsa-miR-1207-3p	CLIP-seq
MIRT1138055	hsa-miR-2467-5p	CLIP-seq
MIRT1138056	hsa-miR-296-3p	CLIP-seq
MIRT1138057	hsa-miR-3135b	CLIP-seq
MIRT1138058	hsa-miR-3180-5p	CLIP-seq
MIRT1138059	hsa-miR-3188	CLIP-seq
MIRT1138060	hsa-miR-3688-5p	CLIP-seq
MIRT1138061	hsa-miR-3975	CLIP-seq
MIRT1138062	hsa-miR-4293	CLIP-seq
MIRT1138063	hsa-miR-4433	CLIP-seq
MIRT1138064	hsa-miR-4649-3p	CLIP-seq
MIRT1138065	hsa-miR-4726-3p	CLIP-seq
MIRT1138066	hsa-miR-485-5p	CLIP-seq
MIRT1138067	hsa-miR-493	CLIP-seq
MIRT1138068	hsa-miR-665	CLIP-seq
MIRT1138054	hsa-miR-1207-3p	CLIP-seq
MIRT2039194	hsa-miR-1207-5p	CLIP-seq
MIRT2039195	hsa-miR-122	CLIP-seq
MIRT2039196	hsa-miR-1303	CLIP-seq
MIRT2039197	hsa-miR-1909	CLIP-seq
MIRT1138056	hsa-miR-296-3p	CLIP-seq
MIRT1138057	hsa-miR-3135b	CLIP-seq
MIRT739828	hsa-miR-3194-5p	CLIP-seq
MIRT2039198	hsa-miR-3652	CLIP-seq
MIRT1138060	hsa-miR-3688-5p	CLIP-seq
MIRT2039199	hsa-miR-4261	CLIP-seq
MIRT2039200	hsa-miR-4430	CLIP-seq
MIRT1138063	hsa-miR-4433	CLIP-seq
MIRT2039201	hsa-miR-4492	CLIP-seq
MIRT2039202	hsa-miR-4498	CLIP-seq
MIRT739830	hsa-miR-4719	CLIP-seq
MIRT2039203	hsa-miR-4736	CLIP-seq
MIRT739829	hsa-miR-4753-5p	CLIP-seq
MIRT2039204	hsa-miR-4763-3p	CLIP-seq
MIRT1138067	hsa-miR-493	CLIP-seq
MIRT739831	hsa-miR-513b	CLIP-seq
MIRT2039205	hsa-miR-762	CLIP-seq

Show/Hide all(63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000123	Component	Histone acetyltransferase complex	IDA	20018852
GO:0000723	Process	Telomere maintenance	IEA
GO:0000723	Process	Telomere maintenance	ISO
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IEA
GO:0000922	Component	Spindle pole	IEA
GO:0002151	Function	G-quadruplex RNA binding	IDA	16571602
GO:0002151	Function	G-quadruplex RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	11948183, 15044100, 16189514, 16230350, 16571602, 17014843, 18922472, 19060904, 21303910, 22609355, 25416956, 31515488, 32296183, 32814053, 33961781, 35914814
GO:0005634	Component	Nucleus	IDA	16571602
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS	9765390
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA	16571602
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	16571602
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9765390
GO:0005764	Component	Lysosome	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006275	Process	Regulation of DNA replication	IMP	25016522
GO:0006281	Process	DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	ISO
GO:0006310	Process	DNA recombination	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IDA	21303910
GO:0006974	Process	DNA damage response	IEA
GO:0008266	Function	Poly(U) RNA binding	IDA	16571602
GO:0010521	Function	Telomerase inhibitor activity	IDA	15044100
GO:0010604	Process	Positive regulation of macromolecule metabolic process	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0031011	Component	Ino80 complex	IDA	21303910
GO:0031011	Component	Ino80 complex	IEA
GO:0032204	Process	Regulation of telomere maintenance	IEA
GO:0033044	Process	Regulation of chromosome organization	IMP	26340092
GO:0034046	Function	Poly(G) binding	IDA	16571602
GO:0034451	Component	Centriolar satellite	IEA
GO:0036211	Process	Protein modification process	TAS	9765390
GO:0043204	Component	Perikaryon	IEA
GO:0043204	Component	Perikaryon	ISS
GO:0044545	Component	NSL complex	IBA
GO:0044545	Component	NSL complex	IDA	20018852
GO:0045739	Process	Positive regulation of DNA repair	IEA
GO:0045739	Process	Positive regulation of DNA repair	ISO
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	27641337
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	24842875
GO:0045935	Process	Positive regulation of nucleobase-containing compound metabolic process	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045995	Process	Regulation of embryonic development	IEA
GO:0045995	Process	Regulation of embryonic development	ISO
GO:0051726	Process	Regulation of cell cycle	IMP	26340092
GO:0060382	Process	Regulation of DNA strand elongation	IMP	25016522
GO:0071339	Component	MLL1 complex	IDA	15960975
GO:0071339	Component	MLL1 complex	IEA
GO:1904357	Process	Negative regulation of telomere maintenance via telomere lengthening	IDA	15044100
GO:1904507	Process	Positive regulation of telomere maintenance in response to DNA damage	IEA
GO:1904507	Process	Positive regulation of telomere maintenance in response to DNA damage	ISO
GO:1904751	Process	Positive regulation of protein localization to nucleolus	IDA	16571602

MIM	HGNC	e!Ensembl
609504	6960	ENSG00000187778

Protein

UniProt ID

Q96EZ8

Protein name

Microspherule protein 1 (58 kDa microspherule protein) (Cell cycle-regulated factor p78) (INO80 complex subunit J) (MCRS2)

Protein function

Modulates the transcription repressor activity of DAXX by recruiting it to the nucleolus (PubMed:11948183). As part of the NSL complex, may be involved in acetylation of nucleosomal histone H4 on several lysine residues (PubMed:20018852). Putati

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13325	MCRS_N	134 → 331	N-terminal region of micro-spherule protein	Family
PF00498	FHA	363 → 436	FHA domain	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in testis, and at lower levels in spleen, thymus, prostate, uterus, small intestine, colon and leukocytes.

Sequence

MDKDSQGLLDSSLMASGTASRSEDEESLAGQKRASSQALGTIPKRRSSSRFIKRKKFDDE
LVESSLAKSSTRAKGASGVEPGRCSGSEPSSSEKKKVSKAPSTPVPPSPAPAPGLTKRVK
KSKQPLQVTKDLGRWKPADDLLLINAVLQTNDLTSVHLGVKFSCRFTLREVQERWYALLY
DPVISKLACQAMRQLHPEAIAAIQSKALFSKAEEQLLSKVGSTSQPTLETFQDLLHRHPD
AFYLARTAKALQAHWQLMKQYYLLEDQTVQPLPKGDQVLNFSDAEDLIDDSKLKDMRDEV
LEHELMVADRRQKREIRQLEQELHKWQVLVDSITGMSSPDFDNQTLAVLRGRMVRYLMRS
REITLGRATKDNQIDVDLSLEGPAWKISRKQGVIKLKNNGDFFIANEGRRPIYIDGRPVL
CGSKWRLSNNSVVEIASLRFVFLINQDLIALIRAEAAKITPQ

Sequence length

462

Interactions

View interactions

	KEGG		Reactome
	ATP-dependent chromatin remodeling		HATs acetylate histones UCH proteinases DNA Damage Recognition in GG-NER

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinogenesis	Associate	19549253
Colorectal Neoplasms	Associate	19549253, 22773039
Glioma	Associate	26849376
Neoplasms	Associate	19549253, 26849376
Pulmonary Blastoma	Stimulate	19549253

MCRS1 (microspherule protein 1)