Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10438
Gene name Gene Name - the full gene name approved by the HGNC.
C1D nuclear receptor corepressor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
C1D
Synonyms (NCBI Gene) Gene synonyms aliases
LRP1, Rrp47, SUN-CoR, SUNCOR, hC1D
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p14
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005157 hsa-miR-30a-5p pSILAC 18668040
MIRT004148 hsa-miR-192-5p Microarray 16822819
MIRT024488 hsa-miR-215-5p Microarray 19074876
MIRT004148 hsa-miR-192-5p Microarray 19074876
MIRT005157 hsa-miR-30a-5p Proteomics;Other 18668040
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000176 Component Nuclear exosome (RNase complex) TAS 17412707
GO:0000178 Component Exosome (RNase complex) IBA
GO:0000460 Process Maturation of 5.8S rRNA IBA
GO:0000460 Process Maturation of 5.8S rRNA IMP 17412707
GO:0003677 Function DNA binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606997 29911 ENSG00000197223
Protein
UniProt ID Q13901
Protein name Nuclear nucleic acid-binding protein C1D (hC1D)
Protein function Plays a role in the recruitment of the RNA exosome complex to pre-rRNA to mediate the 3'-5' end processing of the 5.8S rRNA; this function may include MPHOSPH6. Can activate PRKDC not only in the presence of linear DNA but also in the presence o
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04000 Sas10_Utp3 17 96 Sas10/Utp3/C1D family Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Expressed at very high levels in the hippocampus, medulla oblongata, mammary gland, thyroid and salivary gland. Expressed at high levels in the fetal; lung, liver and kidney. Expressed at low levels in skeletal muscle, appe
Sequence
MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSA
YTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNR
VKEITDKKKAGKLDRGAASRFVKN
ALWEPKSKNASKVANKGKSKS
Sequence length 141
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  RNA degradation   Major pathway of rRNA processing in the nucleolus and cytosol
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Lung adenocarcinoma Familial lung adenocarcinoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Meningioma Associate 20406964
Ovarian Neoplasms Associate 34995016