MYCNOS (MYCN opposite strand)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 10408
Gene name MYCN opposite strand
Gene symbol MYCNOS
Synonyms (NCBI Gene)
MYCN-AS1N-CYMNCYMNYCM
Chromosome 2
Chromosome location 2p24.3
Summary This gene is transcribed in antisense to the v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog gene (MYCN). It is thought to encode a small, novel protein that stabilizes MYCN, prevents apoptosis, and promotes cell proliferation. T
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene Gene ontology Other IDs Protein
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 24391509
GO:0005634 Component Nucleus IDA 24391509
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IDA 24391509
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
605374 16911 ENSG00000233718
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P40205
Protein name N-cym protein (N-myc opposite strand)
Protein function Regulates stability of MYCN in neuroblastoma cells by inhibiting GSK3B-mediated MYCN phosphorylation. Inhibits GSK3B activity by promoting its phosphorylation at 'Ser-9' (PubMed:24391509).
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in the neuronal cells of the cerebrum and cerebellum, spermatocytes of the testis, pancreatic cells and also the heart. Expressed in both primary and metastatic neuroblastomas and in thyroid tumors (at protein level). Express
Sequence 
MQHPPCEPGNCLSLKEKKITEGSGGVCWGGETDASNPAPALTACCAAEREANVEQGLAGR
LLLCNYERRVVRRCKIAGRGRAPLGTRPLDVSSFKLKEEGRPPCLKINK
Sequence length 109
Interactions View interactions