MYCNOS (MYCN opposite strand)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10408
Gene name Gene Name - the full gene name approved by the HGNC.
MYCN opposite strand
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MYCNOS
Synonyms (NCBI Gene) Gene synonyms aliases
MYCN-AS1, N-CYM, NCYM, NYCM
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p24.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is transcribed in antisense to the v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog gene (MYCN). It is thought to encode a small, novel protein that stabilizes MYCN, prevents apoptosis, and promotes cell proliferation. T
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(10)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 24391509
GO:0005634 Component Nucleus IDA 24391509
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IDA 24391509
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
605374 16911 ENSG00000233718
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID P40205
Protein name N-cym protein (N-myc opposite strand)
Protein function Regulates stability of MYCN in neuroblastoma cells by inhibiting GSK3B-mediated MYCN phosphorylation. Inhibits GSK3B activity by promoting its phosphorylation at 'Ser-9' (PubMed:24391509).
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in the neuronal cells of the cerebrum and cerebellum, spermatocytes of the testis, pancreatic cells and also the heart. Expressed in both primary and metastatic neuroblastomas and in thyroid tumors (at protein level). Express
Sequence 
MQHPPCEPGNCLSLKEKKITEGSGGVCWGGETDASNPAPALTACCAAEREANVEQGLAGR
LLLCNYERRVVRRCKIAGRGRAPLGTRPLDVSSFKLKEEGRPPCLKINK
Sequence length 109
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Neuroticism Neuroticism N/A N/A GWAS
Show/Hide Text Mining Associations (4)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Renal Cell Associate 31180525
Neuroblastoma Associate 25880909, 25896758, 34289065
Personality Disorders Associate 25880909
Retinoblastoma Associate 33270844