CPQ (carboxypeptidase Q)

Gene

• Entrez ID: 10404
• Gene name: Carboxypeptidase Q
• Gene symbol: CPQ
• Synonyms (NCBI Gene): LDP, PGCP
• Chromosome: 8
• Chromosome location: 8q22.1
• Summary: This gene encodes a metallopeptidase that belongs to the peptidase M28 family. The encoded protein may catalyze the cleavage of dipeptides with unsubstituted terminals into amino acids. [provided by RefSeq, Jul 2013]

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004180	Function	Carboxypeptidase activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	10206990
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IDA	10206990
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005764	Component	Lysosome	ISS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005794	Component	Golgi apparatus	IDA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	ISS
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IDA	10206990
GO:0006508	Process	Proteolysis	IEA
GO:0006590	Process	Thyroid hormone generation	IBA
GO:0006590	Process	Thyroid hormone generation	IEA
GO:0006590	Process	Thyroid hormone generation	ISS
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0042246	Process	Tissue regeneration	IEA
GO:0042246	Process	Tissue regeneration	ISS
GO:0042803	Function	Protein homodimerization activity	IDA	12675526
GO:0043171	Process	Peptide catabolic process	IBA
GO:0043171	Process	Peptide catabolic process	IDA	10206990
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070573	Function	Metallodipeptidase activity	IBA
GO:0070573	Function	Metallodipeptidase activity	IDA	10206990
GO:0070573	Function	Metallodipeptidase activity	IEA

Other IDs

• MIM: 618754
• HGNC: 16910
• e!Ensembl: ENSG00000104324

Protein

• UniProt ID: Q9Y646
• Protein name: Carboxypeptidase Q (EC 3.4.17.-) (Lysosomal dipeptidase) (Plasma glutamate carboxypeptidase)
• Protein function: Carboxypeptidase that may play an important role in the hydrolysis of circulating peptides. Catalyzes the hydrolysis of dipeptides with unsubstituted terminals into amino acids. May play a role in the liberation of thyroxine hormone from its thy
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04389	Peptidase_M28	270 → 459	Peptidase family M28	Family

• Tissue specificity: TISSUE SPECIFICITY: Mainly detected in blood plasma. Abundant in placenta and kidney. Present at low level in muscles, liver and skin fibroblasts. Not detected in brain or white blood cells (at protein level). {ECO:0000269|PubMed:10206990}.
• Sequence:

  MKFLIFAFFGGVHLLSLCSGKAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQ
  NRSYERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESA
  VMLEPRIHKIAILGLGSSIGTPPEGITAEVLVVTSFDELQRRASEARGKIVVYNQPYINY
  SRTVQYRTQGAVEAAKVGALASLIRSVASFSIYSPHTGIQEYQDGVPKIPTACITVEDAE
  MMSRMASHGIKIVIQLKMGAKTYPDTDSFNTVAEITGSKYPEQVVLVSGHLDSWDVGQGA
  MDDGGGAFISWEALSLIKDLGLRPKRTLRLVLWTAEEQGGVGAFQYYQLHKVNISNYSLV
  MESDAGTFLPTGLQFTGSEKARAIMEEVMSLLQPLNITQVLSHGEGTDINFWIQAGVPGA
  SLLDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVSYVVADMEEMLPRS

• Sequence length: 472