Gene Gene information from NCBI Gene database.
Entrez ID 10400
Gene name Phosphatidylethanolamine N-methyltransferase
Gene symbol PEMT
Synonyms (NCBI Gene)
PEAMTPEMPTPEMT2PLMTPNMT
Chromosome 17
Chromosome location 17p11.2
Summary Phosphatidylcholine (PC) is the most abundant mammalian phospholipid. This gene encodes an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. Another distinct synthetic pathway in nucleated cells
miRNA miRNA information provided by mirtarbase database.
27
miRTarBase ID miRNA Experiments Reference
MIRT022625 hsa-miR-124-3p Microarray 18668037
MIRT1224933 hsa-miR-1 CLIP-seq
MIRT1224934 hsa-miR-1257 CLIP-seq
MIRT1224935 hsa-miR-147 CLIP-seq
MIRT1224936 hsa-miR-206 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
GO ID Ontology Definition Evidence Reference
GO:0000773 Function Phosphatidyl-N-methylethanolamine N-methyltransferase activity IEA
GO:0001835 Process Blastocyst hatching IEA
GO:0004608 Function Phosphatidylethanolamine N-methyltransferase activity IBA
GO:0004608 Function Phosphatidylethanolamine N-methyltransferase activity IEA
GO:0004608 Function Phosphatidylethanolamine N-methyltransferase activity TAS 9989271
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602391 8830 ENSG00000133027
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UBM1
Protein name Phosphatidylethanolamine N-methyltransferase (PEAMT) (PEMT) (EC 2.1.1.17) (EC 2.1.1.71) (PEMT2) (Phospholipid methyltransferase) (PLMT)
Protein function Catalyzes the three sequential steps of the methylation pathway for the biosynthesis of phosphatidylcholine, a critical and essential component for membrane structure (PubMed:12431977, PubMed:15927961). Uses S-adenosylmethionine (S-adenosyl-L-me
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04191 PEMT 88 192 Phospholipid methyltransferase Family
Tissue specificity TISSUE SPECIFICITY: Primarily expressed in liver (at protein level). {ECO:0000269|PubMed:12431977}.
Sequence
MTRLLGYVDPLDPSFVAAVITITFNPLYWNVVARWEHKTRKLSRAFGSPYLACYSLSVTI
LLLNFLRSHCFTQAMLSQPRMESLDTPAAYSLGLALLGLGVVLVLSSFFALGFAGTFLGD
YFGILKEARVTVFPFNILDNPMYWGSTANYLGWAIMHASPTGLLLTVLVALTYIVALLYE
EPFTAEIYRQKA
SGSHKRS
Sequence length 199
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Glycerophospholipid metabolism
Metabolic pathways
  Synthesis of PC