Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10400
Gene name Gene Name - the full gene name approved by the HGNC.
Phosphatidylethanolamine N-methyltransferase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PEMT
Synonyms (NCBI Gene) Gene synonyms aliases
PEAMT, PEMPT, PEMT2, PLMT, PNMT
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
Phosphatidylcholine (PC) is the most abundant mammalian phospholipid. This gene encodes an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. Another distinct synthetic pathway in nucleated cells
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022625 hsa-miR-124-3p Microarray 18668037
MIRT1224933 hsa-miR-1 CLIP-seq
MIRT1224934 hsa-miR-1257 CLIP-seq
MIRT1224935 hsa-miR-147 CLIP-seq
MIRT1224936 hsa-miR-206 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000773 Function Phosphatidyl-N-methylethanolamine N-methyltransferase activity IEA
GO:0001835 Process Blastocyst hatching IEA
GO:0004608 Function Phosphatidylethanolamine N-methyltransferase activity IBA
GO:0004608 Function Phosphatidylethanolamine N-methyltransferase activity IEA
GO:0004608 Function Phosphatidylethanolamine N-methyltransferase activity TAS 9989271
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602391 8830 ENSG00000133027
Protein
UniProt ID Q9UBM1
Protein name Phosphatidylethanolamine N-methyltransferase (PEAMT) (PEMT) (EC 2.1.1.17) (EC 2.1.1.71) (PEMT2) (Phospholipid methyltransferase) (PLMT)
Protein function Catalyzes the three sequential steps of the methylation pathway for the biosynthesis of phosphatidylcholine, a critical and essential component for membrane structure (PubMed:12431977, PubMed:15927961). Uses S-adenosylmethionine (S-adenosyl-L-me
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04191 PEMT 88 192 Phospholipid methyltransferase Family
Tissue specificity TISSUE SPECIFICITY: Primarily expressed in liver (at protein level). {ECO:0000269|PubMed:12431977}.
Sequence
MTRLLGYVDPLDPSFVAAVITITFNPLYWNVVARWEHKTRKLSRAFGSPYLACYSLSVTI
LLLNFLRSHCFTQAMLSQPRMESLDTPAAYSLGLALLGLGVVLVLSSFFALGFAGTFLGD
YFGILKEARVTVFPFNILDNPMYWGSTANYLGWAIMHASPTGLLLTVLVALTYIVALLYE
EPFTAEIYRQKA
SGSHKRS
Sequence length 199
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Glycerophospholipid metabolism
Metabolic pathways
  Synthesis of PC
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Coronary Heart Disease Coronary heart disease N/A N/A GWAS
Diabetes Type 2 diabetes, Triglyceride levels in non-type 2 diabetes N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 18230680, 24675476
Carcinoma Hepatocellular Associate 39533594, 40500772
Chanarin Dorfman Syndrome Associate 21059658
Choline Deficiency Associate 21059658
Fatty Liver Associate 36012560, 37240132, 37513629
Fibrosis Associate 36012560
Gout Associate 39533594
Hepatitis C Associate 37240132
Infertility Associate 21857689
Infertility Male Associate 21857689