Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10392
Gene name	Nucleotide binding oligomerization domain containing 1
Gene symbol	NOD1
Synonyms (NCBI Gene)	CARD4CLR7.1NLRC1hNod1
Chromosome	7
Chromosome location	7p14.3
Summary	This gene encodes a member of the nucleotide-binding oligomerization domain (NOD)-like receptor (NLR) family of proteins. The encoded protein plays a role in innate immunity by acting as a pattern-recognition receptor (PRR) that binds bacterial peptidogly

158

Show/Hide all (158)

miRTarBase ID	miRNA	Experiments	Reference
MIRT735303	hsa-miR-298	Luciferase reporter assayqRT-PCRELISA	32353008
MIRT1188272	hsa-miR-103a	CLIP-seq
MIRT1188273	hsa-miR-107	CLIP-seq
MIRT1188274	hsa-miR-1183	CLIP-seq
MIRT1188275	hsa-miR-1184	CLIP-seq
MIRT1188276	hsa-miR-1205	CLIP-seq
MIRT1188277	hsa-miR-125a-5p	CLIP-seq
MIRT1188278	hsa-miR-125b	CLIP-seq
MIRT1188279	hsa-miR-15a	CLIP-seq
MIRT1188280	hsa-miR-15b	CLIP-seq
MIRT1188281	hsa-miR-16	CLIP-seq
MIRT1188282	hsa-miR-1827	CLIP-seq
MIRT1188283	hsa-miR-195	CLIP-seq
MIRT1188284	hsa-miR-208a	CLIP-seq
MIRT1188285	hsa-miR-208b	CLIP-seq
MIRT1188286	hsa-miR-2467-3p	CLIP-seq
MIRT1188287	hsa-miR-31	CLIP-seq
MIRT1188288	hsa-miR-3125	CLIP-seq
MIRT1188289	hsa-miR-3128	CLIP-seq
MIRT1188290	hsa-miR-3136-3p	CLIP-seq
MIRT1188291	hsa-miR-3137	CLIP-seq
MIRT1188292	hsa-miR-3150b-3p	CLIP-seq
MIRT1188293	hsa-miR-3158-5p	CLIP-seq
MIRT1188294	hsa-miR-3160-3p	CLIP-seq
MIRT1188295	hsa-miR-3190	CLIP-seq
MIRT1188296	hsa-miR-3194-3p	CLIP-seq
MIRT1188297	hsa-miR-3617	CLIP-seq
MIRT1188298	hsa-miR-3658	CLIP-seq
MIRT1188299	hsa-miR-3916	CLIP-seq
MIRT1188300	hsa-miR-424	CLIP-seq
MIRT1188301	hsa-miR-4310	CLIP-seq
MIRT1188302	hsa-miR-4319	CLIP-seq
MIRT1188303	hsa-miR-4434	CLIP-seq
MIRT1188304	hsa-miR-4477a	CLIP-seq
MIRT1188305	hsa-miR-4481	CLIP-seq
MIRT1188306	hsa-miR-4487	CLIP-seq
MIRT1188307	hsa-miR-4493	CLIP-seq
MIRT1188308	hsa-miR-4516	CLIP-seq
MIRT1188309	hsa-miR-4641	CLIP-seq
MIRT1188310	hsa-miR-4696	CLIP-seq
MIRT1188311	hsa-miR-4745-5p	CLIP-seq
MIRT1188312	hsa-miR-4753-5p	CLIP-seq
MIRT1188313	hsa-miR-4758-5p	CLIP-seq
MIRT1188314	hsa-miR-4779	CLIP-seq
MIRT1188315	hsa-miR-4784	CLIP-seq
MIRT1188316	hsa-miR-495	CLIP-seq
MIRT1188317	hsa-miR-497	CLIP-seq
MIRT1188318	hsa-miR-499-5p	CLIP-seq
MIRT1188319	hsa-miR-544	CLIP-seq
MIRT1188320	hsa-miR-556-5p	CLIP-seq
MIRT1188321	hsa-miR-558	CLIP-seq
MIRT1188322	hsa-miR-606	CLIP-seq
MIRT1188323	hsa-miR-617	CLIP-seq
MIRT1188324	hsa-miR-641	CLIP-seq
MIRT1188325	hsa-miR-642b	CLIP-seq
MIRT1188326	hsa-miR-671-5p	CLIP-seq
MIRT1188327	hsa-miR-877	CLIP-seq
MIRT1188328	hsa-miR-940	CLIP-seq
MIRT1551787	hsa-miR-1207-3p	CLIP-seq
MIRT1188282	hsa-miR-1827	CLIP-seq
MIRT1551788	hsa-miR-3612	CLIP-seq
MIRT1551789	hsa-miR-3689a-3p	CLIP-seq
MIRT1551790	hsa-miR-3689c	CLIP-seq
MIRT1551791	hsa-miR-4728-5p	CLIP-seq
MIRT1551792	hsa-miR-650	CLIP-seq
MIRT1188328	hsa-miR-940	CLIP-seq
MIRT1188272	hsa-miR-103a	CLIP-seq
MIRT1188273	hsa-miR-107	CLIP-seq
MIRT1188274	hsa-miR-1183	CLIP-seq
MIRT1188277	hsa-miR-125a-5p	CLIP-seq
MIRT1188278	hsa-miR-125b	CLIP-seq
MIRT1188279	hsa-miR-15a	CLIP-seq
MIRT1188280	hsa-miR-15b	CLIP-seq
MIRT1188281	hsa-miR-16	CLIP-seq
MIRT1188283	hsa-miR-195	CLIP-seq
MIRT1188291	hsa-miR-3137	CLIP-seq
MIRT1188295	hsa-miR-3190	CLIP-seq
MIRT2054549	hsa-miR-3922-5p	CLIP-seq
MIRT1188300	hsa-miR-424	CLIP-seq
MIRT1188301	hsa-miR-4310	CLIP-seq
MIRT1188302	hsa-miR-4319	CLIP-seq
MIRT2054550	hsa-miR-4443	CLIP-seq
MIRT1188305	hsa-miR-4481	CLIP-seq
MIRT1188309	hsa-miR-4641	CLIP-seq
MIRT2054551	hsa-miR-4691-3p	CLIP-seq
MIRT1188311	hsa-miR-4745-5p	CLIP-seq
MIRT1188312	hsa-miR-4753-5p	CLIP-seq
MIRT1188313	hsa-miR-4758-5p	CLIP-seq
MIRT1188317	hsa-miR-497	CLIP-seq
MIRT2054552	hsa-miR-510	CLIP-seq
MIRT2054553	hsa-miR-512-5p	CLIP-seq
MIRT1188326	hsa-miR-671-5p	CLIP-seq
MIRT1188272	hsa-miR-103a	CLIP-seq
MIRT2283619	hsa-miR-106a	CLIP-seq
MIRT2283620	hsa-miR-106b	CLIP-seq
MIRT1188273	hsa-miR-107	CLIP-seq
MIRT1188274	hsa-miR-1183	CLIP-seq
MIRT2283621	hsa-miR-1236	CLIP-seq
MIRT1188277	hsa-miR-125a-5p	CLIP-seq
MIRT1188278	hsa-miR-125b	CLIP-seq
MIRT2283622	hsa-miR-128	CLIP-seq
MIRT2283623	hsa-miR-142-5p	CLIP-seq
MIRT1188279	hsa-miR-15a	CLIP-seq
MIRT1188280	hsa-miR-15b	CLIP-seq
MIRT1188281	hsa-miR-16	CLIP-seq
MIRT2283624	hsa-miR-17	CLIP-seq
MIRT1188283	hsa-miR-195	CLIP-seq
MIRT2283625	hsa-miR-200b	CLIP-seq
MIRT2283626	hsa-miR-200c	CLIP-seq
MIRT2283627	hsa-miR-20a	CLIP-seq
MIRT2283628	hsa-miR-20b	CLIP-seq
MIRT2283629	hsa-miR-27a	CLIP-seq
MIRT2283630	hsa-miR-27b	CLIP-seq
MIRT2283631	hsa-miR-302a	CLIP-seq
MIRT2283632	hsa-miR-302b	CLIP-seq
MIRT2283633	hsa-miR-302c	CLIP-seq
MIRT2283634	hsa-miR-302d	CLIP-seq
MIRT2283635	hsa-miR-302e	CLIP-seq
MIRT2283636	hsa-miR-3153	CLIP-seq
MIRT1188295	hsa-miR-3190	CLIP-seq
MIRT2283637	hsa-miR-369-3p	CLIP-seq
MIRT2283638	hsa-miR-372	CLIP-seq
MIRT2283639	hsa-miR-373	CLIP-seq
MIRT2283640	hsa-miR-374a	CLIP-seq
MIRT2283641	hsa-miR-374b	CLIP-seq
MIRT2283642	hsa-miR-412	CLIP-seq
MIRT1188300	hsa-miR-424	CLIP-seq
MIRT2283643	hsa-miR-429	CLIP-seq
MIRT1188301	hsa-miR-4310	CLIP-seq
MIRT1188302	hsa-miR-4319	CLIP-seq
MIRT1188305	hsa-miR-4481	CLIP-seq
MIRT2283644	hsa-miR-4663	CLIP-seq
MIRT2283645	hsa-miR-4668-5p	CLIP-seq
MIRT2283646	hsa-miR-4685-5p	CLIP-seq
MIRT2283647	hsa-miR-4693-5p	CLIP-seq
MIRT1188310	hsa-miR-4696	CLIP-seq
MIRT2283648	hsa-miR-4699-3p	CLIP-seq
MIRT1188311	hsa-miR-4745-5p	CLIP-seq
MIRT1188313	hsa-miR-4758-5p	CLIP-seq
MIRT2283649	hsa-miR-4802-3p	CLIP-seq
MIRT1188317	hsa-miR-497	CLIP-seq
MIRT2283650	hsa-miR-512-3p	CLIP-seq
MIRT2283651	hsa-miR-513a-5p	CLIP-seq
MIRT2283652	hsa-miR-519d	CLIP-seq
MIRT2283653	hsa-miR-520a-3p	CLIP-seq
MIRT2283654	hsa-miR-520b	CLIP-seq
MIRT2283655	hsa-miR-520c-3p	CLIP-seq
MIRT2283656	hsa-miR-520d-3p	CLIP-seq
MIRT2283657	hsa-miR-520e	CLIP-seq
MIRT2283658	hsa-miR-548u	CLIP-seq
MIRT1188322	hsa-miR-606	CLIP-seq
MIRT1188325	hsa-miR-642b	CLIP-seq
MIRT1188326	hsa-miR-671-5p	CLIP-seq
MIRT2283659	hsa-miR-759	CLIP-seq
MIRT2283660	hsa-miR-93	CLIP-seq
MIRT2455282	hsa-miR-3159	CLIP-seq
MIRT2455283	hsa-miR-4282	CLIP-seq
MIRT2455284	hsa-miR-665	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
NR1I2	Repression	14688115

Show/Hide all (73)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0002221	Process	Pattern recognition receptor signaling pathway	IDA	31649195
GO:0002376	Process	Immune system process	IEA
GO:0002606	Process	Positive regulation of dendritic cell antigen processing and presentation	IEA
GO:0002606	Process	Positive regulation of dendritic cell antigen processing and presentation	ISS
GO:0005515	Function	Protein binding	IPI	15107016, 15657077, 17054981, 17337451, 17420470, 19043560, 19337385, 20534456, 23935490, 29997244, 32814053, 37398436
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	10329646
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	15967716
GO:0005829	Component	Cytosol	IDA	31649195
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	17970764, 31649195
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	31649195
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	10329646
GO:0006952	Process	Defense response	TAS	15967716
GO:0006954	Process	Inflammatory response	TAS	15967716
GO:0007165	Process	Signal transduction	TAS	10329646, 15967716
GO:0007254	Process	JNK cascade	IEA
GO:0008656	Function	Cysteine-type endopeptidase activator activity involved in apoptotic process	TAS	10329646
GO:0009595	Process	Detection of biotic stimulus	TAS	15967716
GO:0010508	Process	Positive regulation of autophagy	IEA
GO:0016020	Component	Membrane	IEA
GO:0016045	Process	Detection of bacterium	IDA	15653568
GO:0016323	Component	Basolateral plasma membrane	IDA	19043560
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	15653568
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032874	Process	Positive regulation of stress-activated MAPK cascade	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	15653568
GO:0038187	Function	Pattern recognition receptor activity	IDA	11058605, 12791997, 12796777, 12871942, 23300079, 31649195, 33942347
GO:0038187	Function	Pattern recognition receptor activity	IEA
GO:0042742	Process	Defense response to bacterium	IDA	11058605, 12791997, 15653568
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042802	Function	Identical protein binding	IDA	10329646
GO:0042802	Function	Identical protein binding	IPI	18186648
GO:0042803	Function	Protein homodimerization activity	IPI	18186648
GO:0042834	Function	Peptidoglycan binding	IDA	12791997, 12796777, 12871942, 16211083
GO:0042834	Function	Peptidoglycan binding	IEA
GO:0042834	Function	Peptidoglycan binding	TAS	15967716
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	10329646
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	12791997
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043130	Function	Ubiquitin binding	IDA	23300079
GO:0044877	Function	Protein-containing complex binding	IPI	17337451
GO:0045087	Process	Innate immune response	IEA
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0050700	Function	CARD domain binding	IDA	10329646
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	12791997, 12796777
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	17054981, 19043560
GO:0051403	Process	Stress-activated MAPK cascade	IEA
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070427	Process	Nucleotide-binding oligomerization domain containing 1 signaling pathway	IDA	11058605, 12791997, 12796777
GO:0070427	Process	Nucleotide-binding oligomerization domain containing 1 signaling pathway	IEA
GO:0071225	Process	Cellular response to muramyl dipeptide	IMP	25093298
GO:0098792	Process	Xenophagy	IEA
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IMP	25093298
GO:1904417	Process	Positive regulation of xenophagy	IEA

MIM	HGNC	e!Ensembl
605980	16390	ENSG00000106100

Q9Y239

Protein name

Nucleotide-binding oligomerization domain-containing protein 1 (hNod1) (Caspase recruitment domain-containing protein 4)

Protein function

Pattern recognition receptor (PRR) that detects bacterial peptidoglycan fragments and other danger signals and thus participates in both innate and adaptive immune responses (PubMed:11058605, PubMed:12791997, PubMed:12796777, PubMed:15044951, Pu

PDB

2B1W , 2DBD , 2NSN , 2NZ7 , 4E9M , 4JQW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00619	CARD	20 → 104	Caspase recruitment domain	Domain
PF05729	NACHT	196 → 368	NACHT domain	Domain
PF17779	NOD2_WH	458 → 515	NOD2 winged helix domain	Domain
PF17776	NLRC4_HD2	517 → 669	NLRC4 helical domain HD2	Domain
PF13516	LRR_6	728 → 749	Leucine Rich repeat	Repeat
PF13516	LRR_6	782 → 805	Leucine Rich repeat	Repeat
PF13516	LRR_6	838 → 861	Leucine Rich repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in adult heart, skeletal muscle, pancreas, spleen and ovary (PubMed:10224040). Also detected in placenta, lung, liver, kidney, thymus, testis, small intestine and colon (PubMed:10224040). {ECO:0000269|PubMed:10224040}.

Sequence

MEEQGHSEMEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCA
CPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLEIGFSPSLLTQSKVV
VNTDPVSRYTQQLRHHLGRDSKFVLCYAQKEELLLEEIYMDTIMELVGFSNESLGSLNSL
ACLLDHTTGILNEQGETIFILGDAGVGKSMLLQRLQSLWATGRLDAGVKFFFHFRCRMFS
CFKESDRLCLQDLLFKHYCYPERDPEEVFAFLLRFPHVALFTFDGLDELHSDLDLSRVPD
SSCPWEPAHPLVLLANLLSGKLLKGASKLLTARTGIEVPRQFLRKKVLLRGFSPSHLRAY
ARRMFPERALQDRLLSQLEANPNLCSLCSVPLFCWIIFRCFQHFRAAFEGSPQLPDCTMT
LTDVFLLVTEVHLNRMQPSSLVQRNTRSPVETLHAGRDTLCSLGQVAHRGMEKSLFVFTQ
EEVQASGLQERDMQLGFLRALPELGPGGDQQSYEFFHLTLQAFFTAFFLVLDDRVGTQEL
LRFFQEWMPPAGAATTSCYPPFLPFQCLQGSGPAREDLFKNKDHFQFTNLFLCGLLSKAK
QKLLRHLVPAAALRRKRKALWAHLFSSLRGYLKSLPRVQVESFNQVQAMPTFIWMLRCIY
ETQSQKVGQLAARGICANYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGV
RELQPCFSRLTVLRLSVNQITDGGVKVLSEELTKYKIVTYLGLYNNQITDVGARYVTKIL
DECKGLTHLKLGKNKITSEGGKYLALAVKNSKSISEVGMWGNQVGDEGAKAFAEALRNHP
SLTTLSLASNGISTEGGKSLARALQQNTSLEILWLTQNELNDEVAESLAEMLKVNQTLKH
LWLIQNQITAKGTAQLADALQSNTGITEICLNGNLIKPEEAKVYEDEKRIICF

Sequence length

953

Interactions

View interactions

	KEGG		Reactome
	NOD-like receptor signaling pathway Epithelial cell signaling in Helicobacter pylori infection Shigellosis Salmonella infection Pertussis		NOD1/2 Signaling Pathway TAK1 activates NFkB by phosphorylation and activation of IKKs complex activated TAK1 mediates p38 MAPK activation JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1 Ovarian tumor domain proteases Interleukin-1 signaling

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Clear cell carcinoma of kidney	Uncertain significance	rs141422065	RCV005929003

Show/Hide Text Mining Associations (61)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	35866781
Arteritis	Associate	22507623
Arthritis Rheumatoid	Stimulate	22143988
Asthma	Associate	16021603, 19587002, 21802003, 23861935
Behcet Syndrome	Associate	26833430
Breast Neoplasms	Associate	29615116, 30791886
Carcinogenesis	Associate	24817964, 29615116, 30791886
Carcinoma Hepatocellular	Associate	35242200, 36920176
Carcinoma Squamous Cell	Associate	35130902, 37369480
Chlamydia Infections	Associate	25854006
Colitis Ulcerative	Associate	19723304
Colitis Ulcerative	Stimulate	24197332
Colorectal Neoplasms	Associate	19843337, 26378020
Communicable Diseases	Associate	21802003
Crohn Disease	Associate	16637007, 17907287
Cystic Fibrosis	Associate	25058850
Diabetes Mellitus Type 2	Stimulate	24018334
Dyspepsia	Associate	27917621
Endometrial Neoplasms	Associate	20646321
Endometriosis	Stimulate	23935397
Fallopian Tube Diseases	Associate	25854006
Gastritis	Associate	28811347
Gastritis Atrophic	Associate	21864388
Gastritis Atrophic	Stimulate	21864388
Gastrointestinal Neoplasms	Associate	29615116
Helicobacter Infections	Associate	22563200, 25933107, 33399167
Infections	Associate	14977954, 25854006
Inflammation	Stimulate	20118240, 23861935, 25253572, 29165176, 30791886
Inflammation	Associate	21310790, 22507623, 25253572, 25854006, 26052894, 28536249, 29615116, 37654182
Inflammatory Bowel Diseases	Associate	16021603, 17595233, 19570976, 19587002, 21802003
Insulin Resistance	Associate	26052894
Intestinal Diseases	Associate	25933107
Leukemia Myeloid Acute	Associate	36076988
Leukemia Prolymphocytic T Cell	Associate	19036098
Lymphatic Metastasis	Associate	24817964
Lymphatic Metastasis	Stimulate	35130902
Lymphoproliferative Syndrome X Linked 2	Associate	23818254
Metabolic Syndrome	Stimulate	26052894
Mucocutaneous Lymph Node Syndrome	Inhibit	22507623
Myocardial Infarction	Associate	35229543
Neoplasm Metastasis	Associate	35130902, 36923216
Neoplasms	Associate	23839082, 24037645, 24817964, 27557518, 32588760, 35130902, 37369480
Neoplasms	Inhibit	29615116, 35787399, 36433652
Neoplasms	Stimulate	37488967
Neoplasms Squamous Cell	Associate	35130902
Neuromyelitis Optica	Associate	35806122
Osteoarthritis	Associate	37853066
Osteoporosis	Associate	32578848
Pancreatic Neoplasms	Associate	25945796
Peptic Ulcer	Stimulate	27917621
Peptic Ulcer	Associate	33399167
Periodontitis	Stimulate	36043447
Pulmonary Disease Chronic Obstructive	Associate	28536249
Sarcoidosis	Associate	16935475, 20851927
Squamous Cell Carcinoma of Head and Neck	Associate	24817964, 27557518
Stomach Diseases	Associate	25933107
Stomach Neoplasms	Associate	21695063, 22563200, 25933107, 33879265
Stomach Neoplasms	Stimulate	27917621
Thyroid Neoplasms	Associate	32588760
Triple Negative Breast Neoplasms	Associate	30791886, 31072371, 36923216
Uterine Cervical Neoplasms	Associate	37488967

NOD1 (nucleotide binding oligomerization domain containing 1)