Gene Gene information from NCBI Gene database.
Entrez ID 10363
Gene name High mobility group 20A
Gene symbol HMG20A
Synonyms (NCBI Gene)
HMGX1HMGXB1
Chromosome 15
Chromosome location 15q24.3
miRNA miRNA information provided by mirtarbase database.
604
miRTarBase ID miRNA Experiments Reference
MIRT050496 hsa-miR-20a-5p CLASH 23622248
MIRT047829 hsa-miR-30c-5p CLASH 23622248
MIRT1048887 hsa-miR-101 CLIP-seq
MIRT1048888 hsa-miR-103a CLIP-seq
MIRT1048889 hsa-miR-107 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 16189514, 23275563, 25416956, 26496610, 26871637, 31515488, 32296183, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605534 5001 ENSG00000140382
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NP66
Protein name High mobility group protein 20A (HMG box-containing protein 20A) (HMG domain-containing protein 1) (HMG domain-containing protein HMGX1)
Protein function Plays a role in neuronal differentiation as chromatin-associated protein. Acts as inhibitor of HMG20B. Overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. Involved in the recruitm
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00505 HMG_box 103 171 HMG (high mobility group) box Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:10773667}.
Sequence
MENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPEFVEDLSQGQL
LQSESSNAAEGNEQRHEDEQRSKRGGWSKGRKRKKPLRDSNAPKSPLTGYVRFMNERREQ
LRAKRPEVPFPEITRMLGNEWSKLPPEEKQRYLDEADRDKERYMKELEQYQ
KTEAYKVFS
RKTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFDIPIFTEEFLNHSKAREAELRQLR
KSNMEFEERNAALQKHVESMRTAVEKLEVDVIQERSRNTVLQQHLETLRQVLTSSFASMP
LPGSGETPTVDTIDSYMNRLHSIILANPQDNENFIATVREVVNRLDR
Sequence length 347
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
HMG20A-related disorder Likely benign rs61755713, rs747117781 RCV003906833
RCV003961568
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Diabetes Gestational Associate 30239167, 30919529
Diabetes Mellitus Type 2 Associate 21874001, 22693455, 26395551, 27175665, 30919529, 32329795
Glucose Intolerance Associate 30239167
Neoplasm Metastasis Associate 36335317
Obesity Associate 22693455, 26395551, 29752338, 30021629
Obesity Stimulate 30021629
Squamous Cell Carcinoma of Head and Neck Associate 36335317