Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10363
Gene name Gene Name - the full gene name approved by the HGNC.
High mobility group 20A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HMG20A
Synonyms (NCBI Gene) Gene synonyms aliases
HMGX1, HMGXB1
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q24.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT050496 hsa-miR-20a-5p CLASH 23622248
MIRT047829 hsa-miR-30c-5p CLASH 23622248
MIRT1048887 hsa-miR-101 CLIP-seq
MIRT1048888 hsa-miR-103a CLIP-seq
MIRT1048889 hsa-miR-107 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 16189514, 23275563, 25416956, 26496610, 26871637, 31515488, 32296183, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605534 5001 ENSG00000140382
Protein
UniProt ID Q9NP66
Protein name High mobility group protein 20A (HMG box-containing protein 20A) (HMG domain-containing protein 1) (HMG domain-containing protein HMGX1)
Protein function Plays a role in neuronal differentiation as chromatin-associated protein. Acts as inhibitor of HMG20B. Overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. Involved in the recruitm
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00505 HMG_box 103 171 HMG (high mobility group) box Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:10773667}.
Sequence
MENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPEFVEDLSQGQL
LQSESSNAAEGNEQRHEDEQRSKRGGWSKGRKRKKPLRDSNAPKSPLTGYVRFMNERREQ
LRAKRPEVPFPEITRMLGNEWSKLPPEEKQRYLDEADRDKERYMKELEQYQ
KTEAYKVFS
RKTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFDIPIFTEEFLNHSKAREAELRQLR
KSNMEFEERNAALQKHVESMRTAVEKLEVDVIQERSRNTVLQQHLETLRQVLTSSFASMP
LPGSGETPTVDTIDSYMNRLHSIILANPQDNENFIATVREVVNRLDR
Sequence length 347
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes with ophthalmic manifestations (PheCode 250.23), Type 2 diabetes with renal manifestations (PheCode 250.22), Type 2 diabetes (PheCode 250.2), Type 2 diabetes with neurological manifestations (PheCode 250.24), Type 2 diabetes N/A N/A GWAS
Hypertension Hypertension (confirmatory factor analysis Factor 12) N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Systemic lupus erythematosus Systemic lupus erythematosus N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Diabetes Gestational Associate 30239167, 30919529
Diabetes Mellitus Type 2 Associate 21874001, 22693455, 26395551, 27175665, 30919529, 32329795
Glucose Intolerance Associate 30239167
Neoplasm Metastasis Associate 36335317
Obesity Associate 22693455, 26395551, 29752338, 30021629
Obesity Stimulate 30021629
Squamous Cell Carcinoma of Head and Neck Associate 36335317