NPM3 (nucleophosmin/nucleoplasmin 3)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10360
Gene name Gene Name - the full gene name approved by the HGNC.
Nucleophosmin/nucleoplasmin 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NPM3
Synonyms (NCBI Gene) Gene synonyms aliases
PORMIN, TMEM123
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q24.32
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. This protein is strongly expressed in diverse cell types where it localizes primarily to the nucleus. Based on its similarity to nucleop
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(815)
miRTarBase ID miRNA Experiments Reference
MIRT022521 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT048670 hsa-miR-99a-5p CLASH 23622248
MIRT553570 hsa-miR-548ac HITS-CLIP 21572407
MIRT553569 hsa-miR-548bb-3p HITS-CLIP 21572407
MIRT553568 hsa-miR-548d-3p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(14)
GO ID Ontology Definition Evidence Reference
GO:0003682 Function Chromatin binding IBA 21873635
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IBA 21873635
GO:0005515 Function Protein binding IPI 22190034, 25416956, 28514442, 31515488, 32296183
GO:0005654 Component Nucleoplasm IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
606456 7931 ENSG00000107833
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID O75607
Protein name Nucleoplasmin-3
Protein function Plays a role in the regulation of diverse cellular processes such as ribosome biogenesis, chromatin remodeling or protein chaperoning (PubMed:20073534, PubMed:22362753). Modulates the histone chaperone function and the RNA-binding activity of nu
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03066 Nucleoplasmin 38 → 139 Nucleoplasmin/nucleophosmin domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11722795}.
Sequence 
MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDA
EHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPV
TFRLKSGSGPVRITGRHQIVTMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP
Sequence length 178
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Lung adenocarcinoma Adenocarcinoma of lung (disorder) rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370
View all (5 more)		 27602772
Show/Hide Text Mining Associations (10)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 37996972
Adenocarcinoma of Lung Associate 37254219
Alzheimer Disease Associate 26512942
Colorectal Neoplasms Associate 39300184
Insomnia Fatal Familial Associate 27338255
Lymphoma Follicular Associate 17255358
Lymphoma Large B Cell Diffuse Stimulate 17255358
Parkinson Disease Associate 26621506
Prostatic Neoplasms Associate 37870957
Prostatitis Associate 37870957