Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10360
Gene name Gene Name - the full gene name approved by the HGNC.
Nucleophosmin/nucleoplasmin 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NPM3
Synonyms (NCBI Gene) Gene synonyms aliases
PORMIN, TMEM123
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q24.32
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. This protein is strongly expressed in diverse cell types where it localizes primarily to the nucleus. Based on its similarity to nucleop
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022521 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT048670 hsa-miR-99a-5p CLASH 23622248
MIRT553570 hsa-miR-548ac HITS-CLIP 21572407
MIRT553569 hsa-miR-548bb-3p HITS-CLIP 21572407
MIRT553568 hsa-miR-548d-3p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003682 Function Chromatin binding IBA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IBA
GO:0005515 Function Protein binding IPI 22190034, 25416956, 28514442, 31515488, 32296183, 33961781
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606456 7931 ENSG00000107833
Protein
UniProt ID O75607
Protein name Nucleoplasmin-3
Protein function Plays a role in the regulation of diverse cellular processes such as ribosome biogenesis, chromatin remodeling or protein chaperoning (PubMed:20073534, PubMed:22362753). Modulates the histone chaperone function and the RNA-binding activity of nu
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03066 Nucleoplasmin 38 139 Nucleoplasmin/nucleophosmin domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11722795}.
Sequence
MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDA
EHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPV
TFRLKSGSGPVRITGRHQI
VTMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP
Sequence length 178
Interactions View interactions
<