Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	10332
Gene name	C-type lectin domain family 4 member M
Gene symbol	CLEC4M
Synonyms (NCBI Gene)	CD209LCD299DC-SIGN2DC-SIGNRDCSIGNRHP10347L-SIGNLSIGN
Chromosome	19
Chromosome location	19p13.2
Summary	This gene encodes a C-type lectin that functions in cell adhesion and pathogen recognition. This receptor recognizes a wide range of evolutionarily divergent pathogens with a large impact on public health, including tuberculosis mycobacteria, and viruses

Show/Hide all (18)

miRTarBase ID	miRNA	Experiments
MIRT896132	hsa-miR-2392	CLIP-seq
MIRT896133	hsa-miR-297	CLIP-seq
MIRT896134	hsa-miR-3149	CLIP-seq
MIRT896135	hsa-miR-3151	CLIP-seq
MIRT896136	hsa-miR-3190	CLIP-seq
MIRT896137	hsa-miR-4447	CLIP-seq
MIRT896138	hsa-miR-4472	CLIP-seq
MIRT896139	hsa-miR-4640-5p	CLIP-seq
MIRT896140	hsa-miR-4651	CLIP-seq
MIRT896141	hsa-miR-4726-5p	CLIP-seq
MIRT896142	hsa-miR-4731-3p	CLIP-seq
MIRT896143	hsa-miR-4801	CLIP-seq
MIRT896144	hsa-miR-4802-5p	CLIP-seq
MIRT896145	hsa-miR-491-5p	CLIP-seq
MIRT896146	hsa-miR-608	CLIP-seq
MIRT896147	hsa-miR-7	CLIP-seq
MIRT2504475	hsa-miR-4468	CLIP-seq
MIRT2504475	hsa-miR-4468	CLIP-seq

Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IDA	15496474, 24623090
GO:0001618	Function	Virus receptor activity	IEA
GO:0001618	Function	Virus receptor activity	IMP	15496474
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32607506, 32766577, 33961781, 34015061, 34341769
GO:0005537	Function	D-mannose binding	IBA
GO:0005537	Function	D-mannose binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	NAS	11337487
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10072769
GO:0006897	Process	Endocytosis	IEA
GO:0006955	Process	Immune response	IBA
GO:0007159	Process	Leukocyte cell-cell adhesion	NAS	11337487
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009988	Process	Cell-cell recognition	IEA
GO:0009988	Process	Cell-cell recognition	TAS	11337487
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	11337487
GO:0019062	Process	Virion attachment to host cell	IEA
GO:0019062	Process	Virion attachment to host cell	TAS	11337487
GO:0019065	Process	Receptor-mediated endocytosis of virus by host cell	NAS	15479853, 32766577
GO:0019079	Process	Viral genome replication	NAS	11337487
GO:0019882	Process	Antigen processing and presentation	NAS	11337487
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030246	Function	Carbohydrate binding	NAS	11337487
GO:0030369	Function	ICAM-3 receptor activity	NAS	11257134
GO:0035556	Process	Intracellular signal transduction	NAS	11337487
GO:0038023	Function	Signaling receptor activity	NAS	11257134
GO:0038187	Function	Pattern recognition receptor activity	IBA
GO:0042605	Function	Peptide antigen binding	NAS	11337487
GO:0043657	Component	Host cell	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0046718	Process	Symbiont entry into host cell	IDA	15479853, 24623090, 32766577
GO:0046790	Function	Virion binding	IEA
GO:0046790	Function	Virion binding	TAS	11337487
GO:0046813	Process	Receptor-mediated virion attachment to host cell	IDA	15479853, 32766577
GO:0046872	Function	Metal ion binding	IEA
GO:0046968	Process	Peptide antigen transport	NAS	11337487
GO:0048306	Function	Calcium-dependent protein binding	IPI	12609975
GO:0075733	Process	Intracellular transport of virus	IEA
GO:0075733	Process	Intracellular transport of virus	TAS	11337487

MIM	HGNC	e!Ensembl
605872	13523	ENSG00000104938

Q9H2X3

Protein name

C-type lectin domain family 4 member M (CD209 antigen-like protein 1) (DC-SIGN-related protein) (DC-SIGNR) (Dendritic cell-specific ICAM-3-grabbing non-integrin 2) (DC-SIGN2) (Liver/lymph node-specific ICAM-3-grabbing non-integrin) (L-SIGN) (CD antigen CD

Protein function

Probable pathogen-recognition receptor involved in peripheral immune surveillance in liver. May mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. Is a receptor for ICAM3, probably by binding to manno

PDB

1K9J , 1SL6 , 1XAR , 1XPH , 3JQH , 8RCY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00059	Lectin_C	285 → 391	Lectin C-type domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly highly expressed in liver sinusoidal endothelial cells and in lymph node. Found in placental endothelium but not in macrophages. Expressed in type II alveolar cells and lung endothelial cells. {ECO:0000269|PubMed:11226297

Sequence

MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGALVLQLLSFML
LAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLK
AAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQE
IYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGE
LPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVR
AQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEP
NNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

Sequence length

399

Interactions

View interactions

	KEGG
	Virion - Human immunodeficiency virus Virion - Flavivirus and Alphavirus Virion - Ebolavirus, Lyssavirus and Morbillivirus Virion - Lassa virus and SFTS virus Phagosome C-type lectin receptor signaling pathway Tuberculosis Measles

CLEC4M (C-type lectin domain family 4 member M)