Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10327
Gene name Gene Name - the full gene name approved by the HGNC.	Aldo-keto reductase family 1 member A1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	AKR1A1
Synonyms (NCBI Gene) Gene synonyms aliases	ALDR1, ALR, ARM, DD3, HEL-S-6
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p34.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member, also known as aldehyde reductase, is involved in the reduction of biogenic and xenobiotic aldehydes and is present i

Show/Hide all(3)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025351	hsa-miR-34a-5p	Proteomics	21566225
MIRT032282	hsa-let-7b-5p	Proteomics	18668040
MIRT045288	hsa-miR-186-5p	CLASH	23622248

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004032	Function	Alditol:NADP+ 1-oxidoreductase activity	IBA	21873635
GO:0004033	Function	Aldo-keto reductase (NADP) activity	TAS
GO:0004745	Function	Retinol dehydrogenase activity	ISS
GO:0005515	Function	Protein binding	IPI	21044950, 32814053
GO:0005615	Component	Extracellular space	HDA	23580065
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006006	Process	Glucose metabolic process	TAS	2498333
GO:0006081	Process	Cellular aldehyde metabolic process	TAS	2498333
GO:0009055	Function	Electron transfer activity	TAS	2498333
GO:0016324	Component	Apical plasma membrane	ISS
GO:0019640	Process	Glucuronate catabolic process to xylulose 5-phosphate	TAS
GO:0019853	Process	L-ascorbic acid biosynthetic process	IEA
GO:0022900	Process	Electron transport chain	IEA
GO:0042840	Process	D-glucuronate catabolic process	IEA
GO:0044597	Process	Daunorubicin metabolic process	IDA	18276838
GO:0044598	Process	Doxorubicin metabolic process	IDA	18276838
GO:0045202	Component	Synapse	IEA
GO:0046185	Process	Aldehyde catabolic process	IEA
GO:0047655	Function	Allyl-alcohol dehydrogenase activity	IEA
GO:0047939	Function	L-glucuronate reductase activity	EXP	7669785
GO:0047939	Function	L-glucuronate reductase activity	IDA	10510318
GO:0047941	Function	Glucuronolactone reductase activity	IDA	10510318
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 20458337, 23533145
GO:0110095	Process	Cellular detoxification of aldehyde	ISS
GO:1901687	Process	Glutathione derivative biosynthetic process	TAS

MIM	HGNC	e!Ensembl
103830	380	ENSG00000117448

Protein

UniProt ID

P14550

Protein name

Aldo-keto reductase family 1 member A1 (EC 1.1.1.2) (EC 1.1.1.372) (EC 1.1.1.54) (Alcohol dehydrogenase [NADP(+)]) (Aldehyde reductase) (Glucuronate reductase) (EC 1.1.1.19) (Glucuronolactone reductase) (EC 1.1.1.20) (S-nitroso-CoA reductase) (ScorR) (EC

Protein function

Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols (PubMed:10510318, PubMed:30538128). Displays enzymatic activity towards endogenous metabolites such as aromatic and alipha

PDB

2ALR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00248	Aldo_ket_red	16 → 294	Aldo/keto reductase family	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Highly expressed in kidney, salivary gland and liver. Detected in trachea, stomach, brain, lung, prostate, placenta, mammary gland, small intestine and lung. {ECO:0000269|PubMed:10486210, ECO:0000269|PubMed:10510318,

Sequence

MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEAL
KEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFER
GDNPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRP
AVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPDEPVLLEEPVVLALAEK
YGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIV
PMLTVDGKRVPRDAGHPLYPFNDPY

Sequence length

325

Interactions

View interactions

	KEGG		Reactome
	Glycolysis / Gluconeogenesis Pentose and glucuronate interconversions Ascorbate and aldarate metabolism Glycerolipid metabolism Pyruvate metabolism Metabolic pathways Biosynthesis of cofactors Chemical carcinogenesis - reactive oxygen species		Glutathione conjugation Formation of xylulose-5-phosphate

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	23468174

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Evidence	Source
Unknown
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients	GWAS, CBGDA
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.	GWAS, CBGDA

Show/Hide Text Mining Associations (34)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	30727821
Alcoholism	Associate	16425414, 23468174, 31933193
Alzheimer Disease	Associate	10600649
Autistic Disorder	Associate	23468174
Breast Neoplasms	Associate	17295732
Carcinogenesis	Associate	21517275
Carcinoma Hepatocellular	Associate	2167445, 29600553, 30653870
Carcinoma Non Small Cell Lung	Associate	29808834
Cardiotoxicity	Associate	24562808
Colorectal Neoplasms	Associate	17517051
Diabetes Complications	Associate	2498333
Digestive System Neoplasms	Associate	11997393
Erythema	Associate	18049455
Esophageal Neoplasms	Associate	23134050
Fatty Liver Alcoholic	Associate	20221393
Fetal Alcohol Spectrum Disorders	Associate	11997393
Fibrosis	Associate	30653870, 31166951
HIV Infections	Associate	31933193
Kabuki syndrome	Associate	24680668
Laryngeal Neoplasms	Associate	22555805
Liver Cirrhosis	Inhibit	31166951
Liver Diseases	Associate	30653870
Myocardial Infarction	Associate	11207350
Neoplasms	Associate	18500343, 21961092, 25526449
Neoplasms Squamous Cell	Associate	30639619
Nervous System Diseases	Associate	23468174
Non alcoholic Fatty Liver Disease	Associate	29718361
Ovarian Neoplasms	Stimulate	39972314
Pancreatic Neoplasms	Associate	21961092
Pancreatitis Chronic	Associate	16425414
Polyendocrinopathies Autoimmune	Associate	8705671
Schizophrenia	Associate	23468174
Squamous Cell Carcinoma of Head and Neck	Associate	20448861, 32238162
Triple Negative Breast Neoplasms	Associate	32350346

AKR1A1 (aldo-keto reductase family 1 member A1)