Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10273
Gene name Gene Name - the full gene name approved by the HGNC.	STIP1 homology and U-box containing protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	STUB1
Synonyms (NCBI Gene) Gene synonyms aliases	CHIP, HSPABP2, NY-CO-7, SCA48, SCAR16, SDCCAG7, UBOX1
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein containing tetratricopeptide repeat and a U-box that functions as a ubiquitin ligase/cochaperone. The encoded protein binds to and ubiquitinates shock cognate 71 kDa protein (Hspa8) and DNA polymerase beta (Polb), among other t

Show/Hide all(77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028574	hsa-miR-30a-5p	Proteomics	18668040
MIRT029709	hsa-miR-26b-5p	Microarray	19088304
MIRT1399920	hsa-miR-1178	CLIP-seq
MIRT1399921	hsa-miR-1275	CLIP-seq
MIRT1399922	hsa-miR-1290	CLIP-seq
MIRT1399923	hsa-miR-1913	CLIP-seq
MIRT1399924	hsa-miR-1915	CLIP-seq
MIRT1399925	hsa-miR-198	CLIP-seq
MIRT1399926	hsa-miR-324-3p	CLIP-seq
MIRT1399927	hsa-miR-331-3p	CLIP-seq
MIRT1399928	hsa-miR-3677-5p	CLIP-seq
MIRT1399929	hsa-miR-3690	CLIP-seq
MIRT1399930	hsa-miR-3924	CLIP-seq
MIRT1399931	hsa-miR-3941	CLIP-seq
MIRT1399932	hsa-miR-4271	CLIP-seq
MIRT1399933	hsa-miR-4308	CLIP-seq
MIRT1399934	hsa-miR-4435	CLIP-seq
MIRT1399935	hsa-miR-4525	CLIP-seq
MIRT1399936	hsa-miR-4651	CLIP-seq
MIRT1399937	hsa-miR-466	CLIP-seq
MIRT1399938	hsa-miR-4665-5p	CLIP-seq
MIRT1399939	hsa-miR-4672	CLIP-seq
MIRT1399940	hsa-miR-4685-5p	CLIP-seq
MIRT1399941	hsa-miR-4688	CLIP-seq
MIRT1399942	hsa-miR-4723-5p	CLIP-seq
MIRT1399943	hsa-miR-4725-3p	CLIP-seq
MIRT1399944	hsa-miR-4727-5p	CLIP-seq
MIRT1399945	hsa-miR-4803	CLIP-seq
MIRT1399946	hsa-miR-520a-5p	CLIP-seq
MIRT1399947	hsa-miR-525-5p	CLIP-seq
MIRT1399948	hsa-miR-556-3p	CLIP-seq
MIRT1399949	hsa-miR-608	CLIP-seq
MIRT1399950	hsa-miR-625	CLIP-seq
MIRT1399951	hsa-miR-873	CLIP-seq
MIRT1399952	hsa-miR-922	CLIP-seq
MIRT1399921	hsa-miR-1275	CLIP-seq
MIRT2119911	hsa-miR-132	CLIP-seq
MIRT1399925	hsa-miR-198	CLIP-seq
MIRT2119912	hsa-miR-212	CLIP-seq
MIRT1399930	hsa-miR-3924	CLIP-seq
MIRT2119913	hsa-miR-4261	CLIP-seq
MIRT1399934	hsa-miR-4435	CLIP-seq
MIRT1399935	hsa-miR-4525	CLIP-seq
MIRT2119914	hsa-miR-455-3p	CLIP-seq
MIRT2119915	hsa-miR-4663	CLIP-seq
MIRT1399938	hsa-miR-4665-5p	CLIP-seq
MIRT2119916	hsa-miR-4690-3p	CLIP-seq
MIRT1399942	hsa-miR-4723-5p	CLIP-seq
MIRT2119917	hsa-miR-4728-3p	CLIP-seq
MIRT1399945	hsa-miR-4803	CLIP-seq
MIRT1399946	hsa-miR-520a-5p	CLIP-seq
MIRT1399947	hsa-miR-525-5p	CLIP-seq
MIRT2119918	hsa-miR-545	CLIP-seq
MIRT2119919	hsa-miR-548p	CLIP-seq
MIRT1399950	hsa-miR-625	CLIP-seq
MIRT1399951	hsa-miR-873	CLIP-seq
MIRT1399952	hsa-miR-922	CLIP-seq
MIRT1399921	hsa-miR-1275	CLIP-seq
MIRT2119911	hsa-miR-132	CLIP-seq
MIRT1399925	hsa-miR-198	CLIP-seq
MIRT2119912	hsa-miR-212	CLIP-seq
MIRT2119913	hsa-miR-4261	CLIP-seq
MIRT1399932	hsa-miR-4271	CLIP-seq
MIRT1399935	hsa-miR-4525	CLIP-seq
MIRT2119914	hsa-miR-455-3p	CLIP-seq
MIRT2119915	hsa-miR-4663	CLIP-seq
MIRT1399938	hsa-miR-4665-5p	CLIP-seq
MIRT2119916	hsa-miR-4690-3p	CLIP-seq
MIRT1399942	hsa-miR-4723-5p	CLIP-seq
MIRT1399943	hsa-miR-4725-3p	CLIP-seq
MIRT2119917	hsa-miR-4728-3p	CLIP-seq
MIRT1399946	hsa-miR-520a-5p	CLIP-seq
MIRT1399947	hsa-miR-525-5p	CLIP-seq
MIRT2119918	hsa-miR-545	CLIP-seq
MIRT2119919	hsa-miR-548p	CLIP-seq
MIRT1399950	hsa-miR-625	CLIP-seq
MIRT1399952	hsa-miR-922	CLIP-seq

Show/Hide all(119)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IDA	12150907, 16275660, 16307917
GO:0000165	Process	MAPK cascade	IEA
GO:0000165	Process	MAPK cascade	ISS
GO:0000209	Process	Protein polyubiquitination	IBA
GO:0000209	Process	Protein polyubiquitination	IDA	15781469, 16275660
GO:0000209	Process	Protein polyubiquitination	IEA
GO:0000209	Process	Protein polyubiquitination	IMP	19713937
GO:0001664	Function	G protein-coupled receptor binding	IPI	12150907
GO:0002931	Process	Response to ischemia	IEA
GO:0002931	Process	Response to ischemia	ISS
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	15466472
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IMP	19713937
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS	16307917
GO:0005515	Function	Protein binding	IPI	11146632, 16207813, 16275660, 16293251, 16307917, 16809764, 18292230, 19196961, 19423554, 19483080, 19875381, 20029029, 20588253, 20618441, 20724525, 21044950, 21358815, 21360678, 22190034, 22366786, 23431407, 23973223, 24510904, 24613385, 24658140, 24981860, 25036637, 25260751, 252
GO:0005634	Component	Nucleus	IDA	23973223
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	10330192, 16831871
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005783	Component	Endoplasmic reticulum	IDA	12150907
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IGI	18292230
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IMP	19713937, 23990462
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	ISS	18292230
GO:0006513	Process	Protein monoubiquitination	IDA	24043303
GO:0006515	Process	Protein quality control for misfolded or incompletely synthesized proteins	IBA
GO:0006515	Process	Protein quality control for misfolded or incompletely synthesized proteins	IDA	16831871
GO:0006515	Process	Protein quality control for misfolded or incompletely synthesized proteins	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0009893	Process	Positive regulation of metabolic process	IEA
GO:0010614	Process	Negative regulation of cardiac muscle hypertrophy	IEA
GO:0016567	Process	Protein ubiquitination	IDA	14610072, 16809764
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	IMP	16809764, 29883609
GO:0016740	Function	Transferase activity	IEA
GO:0019899	Function	Enzyme binding	IPI	16280320
GO:0019900	Function	Kinase binding	IPI	17512523
GO:0030018	Component	Z disc	IBA
GO:0030018	Component	Z disc	IEA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IMP	15781469, 24613385
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	TAS
GO:0030544	Function	Hsp70 protein binding	IDA	10330192, 23990462
GO:0030544	Function	Hsp70 protein binding	IPI	24613385
GO:0030674	Function	Protein-macromolecule adaptor activity	TAS	16307917
GO:0030911	Function	TPR domain binding	IDA	11146632
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IEA
GO:0031072	Function	Heat shock protein binding	IPI	16207813
GO:0031371	Component	Ubiquitin conjugating enzyme complex	TAS	16307917
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	11146632, 16831871
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	12150907
GO:0031647	Process	Regulation of protein stability	IDA	16809764
GO:0031943	Process	Regulation of glucocorticoid metabolic process	IDA	11146632
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	11146632
GO:0034392	Process	Negative regulation of smooth muscle cell apoptotic process	IEA
GO:0034392	Process	Negative regulation of smooth muscle cell apoptotic process	IMP	20724525
GO:0034392	Process	Negative regulation of smooth muscle cell apoptotic process	ISS
GO:0034393	Process	Positive regulation of smooth muscle cell apoptotic process	IEA
GO:0034393	Process	Positive regulation of smooth muscle cell apoptotic process	ISS
GO:0034450	Function	Ubiquitin-ubiquitin ligase activity	IEA
GO:0034450	Function	Ubiquitin-ubiquitin ligase activity	ISS
GO:0034605	Process	Cellular response to heat	IEA
GO:0034605	Process	Cellular response to heat	ISS
GO:0035359	Process	Negative regulation of peroxisome proliferator activated receptor signaling pathway	IEA
GO:0035359	Process	Negative regulation of peroxisome proliferator activated receptor signaling pathway	ISS
GO:0036503	Process	ERAD pathway	IMP	23990462
GO:0038128	Process	ERBB2 signaling pathway	TAS
GO:0042405	Component	Nuclear inclusion body	IDA	16831871
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	23990462
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	15781469, 19713937, 24613385
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	29883609
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS	19953350
GO:0045862	Process	Positive regulation of proteolysis	IBA
GO:0045862	Process	Positive regulation of proteolysis	IMP	26634371
GO:0046332	Function	SMAD binding	IPI	24613385
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0050821	Process	Protein stabilization	IDA	24043303
GO:0051087	Function	Protein-folding chaperone binding	IBA
GO:0051087	Function	Protein-folding chaperone binding	IEA
GO:0051087	Function	Protein-folding chaperone binding	IPI	16207813
GO:0051787	Function	Misfolded protein binding	IDA	16831871
GO:0051865	Process	Protein autoubiquitination	IDA	16307917, 18042044
GO:0051879	Function	Hsp90 protein binding	IDA	11146632
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	14610072, 16275660, 16809764, 19103148, 24043303, 24613385, 26265139
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IGI	16207813
GO:0061630	Function	Ubiquitin protein ligase activity	IMP	15781469, 16809764, 23990462
GO:0061630	Function	Ubiquitin protein ligase activity	TAS
GO:0061684	Process	Chaperone-mediated autophagy	IEA
GO:0070412	Function	R-SMAD binding	IPI	15781469
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	16307917
GO:0071218	Process	Cellular response to misfolded protein	IBA
GO:0071218	Process	Cellular response to misfolded protein	IDA	16831871
GO:0071218	Process	Cellular response to misfolded protein	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071456	Process	Cellular response to hypoxia	ISS
GO:0090035	Process	Positive regulation of chaperone-mediated protein complex assembly	IDA	16831871
GO:0101031	Component	Protein folding chaperone complex	IPI	16207813
GO:1901526	Process	Positive regulation of mitophagy	IEA
GO:1901526	Process	Positive regulation of mitophagy	ISS
GO:1904294	Process	Positive regulation of ERAD pathway	IMP	26265139
GO:1904694	Process	Negative regulation of vascular associated smooth muscle contraction	IEA

MIM	HGNC	e!Ensembl
607207	11427	ENSG00000103266

Protein

UniProt ID

Q9UNE7

Protein name

E3 ubiquitin-protein ligase CHIP (EC 2.3.2.27) (Antigen NY-CO-7) (CLL-associated antigen KW-8) (Carboxy terminus of Hsp70-interacting protein) (RING-type E3 ubiquitin transferase CHIP) (STIP1 homology and U box-containing protein 1)

Protein function

E3 ubiquitin-protein ligase which targets misfolded chaperone substrates towards proteasomal degradation (PubMed:10330192, PubMed:11146632, PubMed:11557750, PubMed:23990462, PubMed:26265139). Plays a role in the maintenance of mitochondrial morp

PDB

4KBQ , 6EFK , 6NSV , 7TB1 , 8EHZ , 8EI0 , 8F14 , 8F15 , 8F16 , 8F17 , 8FYU , 8GCK , 8SUV , 9DRY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12895	ANAPC3	39 → 120		Domain
PF18391	CHIP_TPR_N	142 → 225	CHIP N-terminal tetratricopeptide repeat domain	Domain
PF04564	U-box	227 → 299	U-box domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in differentiated myotubes (at protein level) (PubMed:17369820). Highly expressed in skeletal muscle, heart, pancreas, brain and placenta (PubMed:10330192, PubMed:11435423). Detected in kidney, liver and lung (PubMed:10330192

Sequence

MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVA
VYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRA
YSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEEC
QRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELM
REPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWV
EDY

Sequence length

303

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis Protein processing in endoplasmic reticulum		Downregulation of TGF-beta receptor signaling Downregulation of ERBB2 signaling Regulation of RUNX2 expression and activity Regulation of PTEN stability and activity Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Spinocerebellar Ataxia	Spinocerebellar ataxia 48, Autosomal recessive spinocerebellar ataxia 16	rs754446573, rs587777347, rs690016544, rs1555475283, rs587777340, rs1555475375, rs587777341, rs760424025, rs587777342, rs1555475794, rs587777344, rs748984540, rs587777345, rs1567283195, rs587777346	N/A

Show/Hide Text Mining Associations (53)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alopecia	Associate	25258038
Alzheimer Disease	Associate	21220432
Arthritis Rheumatoid	Stimulate	35943876
Arthritis Rheumatoid	Associate	37604355
Ataxia	Associate	24742043, 28193273, 32713943, 33811518, 34070858, 36422518
Ataxia Sensory Autosomal Dominant	Associate	33811518
Atrophy	Associate	36476347
Autonomic Nervous System Diseases	Associate	28193273
Breast Neoplasms	Associate	29510992
Carcinoma Hepatocellular	Associate	37515378
Cerebellar Ataxia	Associate	28193273, 32713943, 36476347, 37379724
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Associate	28193273, 29679845
Cerebellar Diseases	Associate	34070858
Cognition Disorders	Associate	24742043, 25258038, 32713943, 33811518, 34070858
Cognitive Dysfunction	Associate	32713943
Colitis Ulcerative	Associate	25258038
Colorectal Neoplasms	Associate	34890713
Dementia	Associate	28193273, 33097556
Diabetes Mellitus	Associate	25258038
Elliptocytosis 1	Associate	25258038
Encephalopathy Spastic Tetraparesis and Hypogonadism	Associate	28193273
Epilepsy	Associate	28193273, 33097556
Gait Disorders Neurologic	Associate	32713943, 33097556
Gastrointestinal Stromal Tumors	Associate	38110356
Genetic Diseases Inborn	Associate	33811518, 34906452
Glioma	Associate	26370624
Hereditary Breast and Ovarian Cancer Syndrome	Associate	29510992
Huntington Disease	Associate	32713943
Huntington Disease Like Syndrome	Associate	36476347
Hypogonadism	Associate	25258038, 28193273
Hypoxia Brain	Associate	32176739
Leukemia	Associate	28536267
Leukemia Myeloid	Associate	28536267
Mental Disorders	Associate	34070858
Mesothelioma	Associate	26254420
Mesothelioma Malignant	Associate	26254420
Mouth Neoplasms	Inhibit	32553686
Muscle Spasticity	Associate	24742043
Neoplasm Invasiveness	Stimulate	35920319
Neoplasms	Inhibit	29510992, 32553686
Neurodegenerative Diseases	Associate	28193273, 29679845, 30605842, 33097556, 35398354
Parkinsonian Disorders	Associate	33811518
Pierre Robin Syndrome	Stimulate	34445196
Spastic Ataxia	Associate	24742043
Spinocerebellar Ataxia 11	Associate	37301203
Spinocerebellar Ataxia 15	Associate	28396517, 29679845, 32713943, 33097556, 36892293
Spinocerebellar Ataxia 17	Associate	34906452, 36476347
Spinocerebellar Ataxia Autosomal Recessive 8	Associate	25258038
Spinocerebellar Ataxias	Associate	28396517, 29679845, 33097556, 33811518, 34070858, 34565360, 34906452, 35398354, 36422518, 36892293
Spinocerebellar Degenerations	Associate	25259530, 34445196
Squamous Intraepithelial Lesions	Associate	35920319
Uveitis	Associate	25258038
Wallerian degeneration of the pyramidal tract	Associate	24742043

STUB1 (STIP1 homology and U-box containing protein 1)