Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10262
Gene name Gene Name - the full gene name approved by the HGNC.
Splicing factor 3b subunit 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SF3B4
Synonyms (NCBI Gene) Gene synonyms aliases
AFD1, Hsh49, SAP49, SF3b49
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes one of four subunits of the splicing factor 3B. The protein encoded by this gene cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the prespliceosomal complex A. It also may be involv
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs387907185 T>C Pathogenic Initiator codon variant, missense variant
rs387907186 G>-,GG Pathogenic Coding sequence variant, frameshift variant
rs397515324 G>A Pathogenic Coding sequence variant, stop gained
rs782357237 ->G Pathogenic Coding sequence variant, frameshift variant
rs797044869 C>T Likely-pathogenic Splice acceptor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT051835 hsa-let-7c-5p CLASH 23622248
MIRT047686 hsa-miR-10a-5p CLASH 23622248
MIRT042581 hsa-miR-423-3p CLASH 23622248
MIRT038362 hsa-miR-296-3p CLASH 23622248
MIRT1341553 hsa-miR-122 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000375 Process RNA splicing, via transesterification reactions TAS 7958871
GO:0000398 Process MRNA splicing, via spliceosome IBA
GO:0000398 Process MRNA splicing, via spliceosome IC 9731529
GO:0000398 Process MRNA splicing, via spliceosome IDA 27720643, 29360106, 32494006, 36797247
GO:0000398 Process MRNA splicing, via spliceosome IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605593 10771 ENSG00000143368
Protein
UniProt ID Q15427
Protein name Splicing factor 3B subunit 4 (Pre-mRNA-splicing factor SF3b 49 kDa subunit) (Spliceosome-associated protein 49) (SAP 49)
Protein function Component of the 17S U2 SnRNP complex of the spliceosome, a large ribonucleoprotein complex that removes introns from transcribed pre-mRNAs (PubMed:10882114, PubMed:12234937, PubMed:27720643, PubMed:32494006). The 17S U2 SnRNP complex (1) direct
PDB 1X5T , 5GVQ , 5Z56 , 5Z57 , 5Z58 , 6AH0 , 6AHD , 6QX9 , 6Y53 , 6Y5Q , 7ABG , 7ABH , 7ABI , 7DVQ , 7EVO , 7ONB , 7QTT , 7VPX , 8CH6 , 8H6E , 8H6J , 8H6K , 8H6L , 8HK1 , 8I0P , 8I0R , 8I0S , 8I0T , 8I0U , 8I0V , 8QO9 , 8QXD , 8QZS , 8R08 , 8R09 , 8R0A , 8R0B , 8RM5 , 8Y7E
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 15 85 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 102 173 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Sequence
MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE
FLSEEDADYAIKIMNMIKLYGKPIR
VNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTF
SAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPIT
VSYAFKK
DSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPP
GSFPPPVPPPGALPPGIPPAMPPPPMPPGAAGHGPPSAGTPGAGHPGHGHSHPHPFPPGG
MPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPFGS
PMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGPLRG
PLPQ
Sequence length 424
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Spliceosome   mRNA Splicing - Major Pathway
mRNA Splicing - Minor Pathway
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Nager Syndrome nager syndrome rs387907185, rs797045129, rs387907186, rs797045130, rs797045125, rs797045131, rs397515324, rs797045132, rs797045121, rs797045133, rs797045122, rs797045134, rs797045123, rs797045954, rs797045124
View all (6 more)
N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Acrofacial Dysostosis Nager acrofacial dysostosis, acrofacial dysostosis Rodriguez type N/A N/A GenCC
Diabetes Type 2 diabetes N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acrofacial dysostosis Nager type Associate 22541558, 27622494, 27966544, 32537850, 36639679
Acrofacial dysostosis Rodriguez type Associate 27622494
Adenocarcinoma of Lung Associate 35852380, 38168564
Anophthalmos with limb anomalies Associate 32537850
Breast Neoplasms Associate 37551622
Carcinogenesis Associate 28351319, 29397868, 35996826, 36639679, 38168564, 40234915
Carcinoma Hepatocellular Associate 29397868, 30391496, 31811111, 33411682, 35030977, 40234915
Carcinoma Hepatocellular Stimulate 37899451
Carcinoma Non Small Cell Lung Associate 35852380, 35996826
Carcinoma Renal Cell Associate 36639679