Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10238
Gene name Gene Name - the full gene name approved by the HGNC.
DDB1 and CUL4 associated factor 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DCAF7
Synonyms (NCBI Gene) Gene synonyms aliases
AN11, HAN11, SWAN-1, WDR68
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein with multiple WD40 repeats which facilitate protein-protein interactions and thereby enable the assembly of multiprotein complexes. This protein has been shown to function as a scaffold protein for protein complexes involved in
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005255 hsa-miR-155-5p pSILAC 18668040
MIRT016519 hsa-miR-193b-3p Microarray 20304954
MIRT005255 hsa-miR-155-5p Proteomics 18668040
MIRT025855 hsa-miR-7-5p Microarray 19073608
MIRT031255 hsa-miR-19b-3p Sequencing 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 14593110, 14743216, 20940704, 21328542, 23602568, 25959826, 27173435, 27307198, 27705803, 32707033, 32814053, 33961781, 35016035, 36950384
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005654 Component Nucleoplasm TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605973 30915 ENSG00000136485
Protein
UniProt ID P61962
Protein name DDB1- and CUL4-associated factor 7 (WD repeat-containing protein 68) (WD repeat-containing protein An11 homolog)
Protein function Involved in craniofacial development. Acts upstream of the EDN1 pathway and is required for formation of the upper jaw equivalent, the palatoquadrate. The activity required for EDN1 pathway function differs between the first and second arches (B
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 256 295 WD domain, G-beta repeat Repeat
Sequence
MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFI
CRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFC
APLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDI
AFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATM
AMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMP
RAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV
Sequence length 342
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Polycomb repressive complex   Neddylation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Down Syndrome Associate 30496304
Epidermodysplasia Verruciformis Associate 23637414