Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10202
Gene name Gene Name - the full gene name approved by the HGNC.	Dehydrogenase/reductase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DHRS2
Synonyms (NCBI Gene) Gene synonyms aliases	HEP27, SDR25C1
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q11.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family, which has over 46,000 members. Members of this family are enzymes that metabolize many different compounds, such as steroid hormones, prostaglandins, retinoids, lipids a

Show/Hide all(31)

miRTarBase ID	miRNA	Experiments
MIRT934930	hsa-miR-1226	CLIP-seq
MIRT934931	hsa-miR-29a	CLIP-seq
MIRT934932	hsa-miR-29b	CLIP-seq
MIRT934933	hsa-miR-29c	CLIP-seq
MIRT934934	hsa-miR-330-3p	CLIP-seq
MIRT934935	hsa-miR-4267	CLIP-seq
MIRT934936	hsa-miR-4691-5p	CLIP-seq
MIRT2212116	hsa-miR-2053	CLIP-seq
MIRT2212117	hsa-miR-302f	CLIP-seq
MIRT2212118	hsa-miR-3128	CLIP-seq
MIRT2212119	hsa-miR-3148	CLIP-seq
MIRT2212120	hsa-miR-3157-5p	CLIP-seq
MIRT2212121	hsa-miR-3173-3p	CLIP-seq
MIRT2212122	hsa-miR-4305	CLIP-seq
MIRT2212123	hsa-miR-4422	CLIP-seq
MIRT2212124	hsa-miR-4428	CLIP-seq
MIRT2212125	hsa-miR-4496	CLIP-seq
MIRT2212126	hsa-miR-4521	CLIP-seq
MIRT2212127	hsa-miR-4522	CLIP-seq
MIRT2212128	hsa-miR-4659a-3p	CLIP-seq
MIRT2212129	hsa-miR-4659b-3p	CLIP-seq
MIRT2212130	hsa-miR-4691-3p	CLIP-seq
MIRT2212131	hsa-miR-4720-3p	CLIP-seq
MIRT2212132	hsa-miR-4720-5p	CLIP-seq
MIRT2212133	hsa-miR-4762-5p	CLIP-seq
MIRT2212134	hsa-miR-4771	CLIP-seq
MIRT2212135	hsa-miR-4778-3p	CLIP-seq
MIRT2212136	hsa-miR-4799-3p	CLIP-seq
MIRT2212137	hsa-miR-4804-3p	CLIP-seq
MIRT2212138	hsa-miR-569	CLIP-seq
MIRT2212139	hsa-miR-651	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
MYB	Unknown	15105423
MYBL1	Unknown	15105423

Show/Hide all(14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004090	Function	Carbonyl reductase (NADPH) activity	IDA	16685466
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005634	Component	Nucleus	IDA	1847869
GO:0005635	Component	Nuclear envelope	IDA	11997086
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	11944995, 11997086
GO:0005739	Component	Mitochondrion	IDA	19443906
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0008207	Process	C21-steroid hormone metabolic process	NAS	7556196
GO:0008285	Process	Negative regulation of cell population proliferation	NAS	1847869
GO:0009636	Process	Response to toxic substance	IDA	16685466
GO:0034599	Process	Cellular response to oxidative stress	IDA	19443906
GO:0043011	Process	Myeloid dendritic cell differentiation	IEP	11944995
GO:0043066	Process	Negative regulation of apoptotic process	IMP	19443906

MIM	HGNC	e!Ensembl
615194	18349	ENSG00000100867

Protein

UniProt ID

Q13268

Protein name

Dehydrogenase/reductase SDR family member 2, mitochondrial (EC 1.1.1.-) (Dicarbonyl reductase HEP27) (Protein D) (Short chain dehydrogenase/reductase family 25C member 1) (Protein SDR25C1)

Protein function

NADPH-dependent oxidoreductase which catalyzes the reduction of dicarbonyl compounds. Displays reductase activity in vitro with 3,4-hexanedione, 2,3-heptanedione and 1-phenyl-1,2-propanedione as substrates (PubMed:16685466). May function as a di

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13561	adh_short_C2	43 → 277		Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, with highest levels in liver and kidney, followed by heart, spleen, skeletal muscle and placenta. In hemopoietic cells, expressed in dendritic cells, but not in monocytes, macrophages, granulocytes, nor in B and T lym

Sequence

MLSAVARGYQGWFHPCARLSVRMSSTGIDRKGVLANRVAVVTGSTSGIGFAIARRLARDG
AHVVISSRKQQNVDRAMAKLQGEGLSVAGIVCHVGKAEDREQLVAKALEHCGGVDFLVCS
AGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQLLPYMENRRGAVILVSSIAAYNPVV
ALGVYNVSKTALLGLTRTLALELAPKDIRVNCVVPGIIKTDFSKVFHGNESLWKNFKEHH
QLQRIGESEDCAGIVSFLCSPDASYVNGENIAVAGYSTRL

Sequence length

280

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Dementia	Dementia	GWAS
Alzheimer disease	Alzheimer disease	GWAS
Diabetes	Diabetes	GWAS

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	20547751, 36594618
Carcinoma Hepatocellular	Associate	33667649
Carcinoma Renal Cell	Associate	37119764
Colorectal Neoplasms	Associate	31436301
Endometrial Neoplasms	Associate	35401936
Hepatoblastoma	Associate	7556196
Leukemia Myeloid Acute	Associate	32586085
Neoplasm Metastasis	Inhibit	36192391
Neoplasms	Inhibit	32586085, 36192391
Neoplasms	Associate	36594618
Ovarian Neoplasms	Inhibit	31423895, 36192391

DHRS2 (dehydrogenase/reductase 2)