Gene Gene information from NCBI Gene database.
Entrez ID 10140
Gene name Transducer of ERBB2, 1
Gene symbol TOB1
Synonyms (NCBI Gene)
APRO5APRO6PIG49TOBTROBTROB1
Chromosome 17
Chromosome location 17q21.33
Summary This gene encodes a member of the transducer of erbB-2 /B-cell translocation gene protein family. Members of this family are anti-proliferative factors that have the potential to regulate cell growth. The encoded protein may function as a tumor suppressor
miRNA miRNA information provided by mirtarbase database.
477
miRTarBase ID miRNA Experiments Reference
MIRT007049 hsa-miR-218-5p Luciferase reporter assay 23060446
MIRT050970 hsa-miR-17-5p CLASH 23622248
MIRT039574 hsa-miR-641 CLASH 23622248
MIRT077897 hsa-miR-25-3p PAR-CLIP 20371350
MIRT077898 hsa-miR-32-5p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0003714 Function Transcription corepressor activity IBA
GO:0003714 Function Transcription corepressor activity IEA
GO:0005515 Function Protein binding IPI 18377426, 19276069, 20595394, 21336257, 26496610, 28514442, 31515488, 32814053, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605523 11979 ENSG00000141232
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P50616
Protein name Protein Tob1 (Transducer of erbB-2 1)
Protein function Anti-proliferative protein; the function is mediated by association with deadenylase subunits of the CCR4-NOT complex (PubMed:23236473, PubMed:8632892). Mediates CPEB3-accelerated mRNA deadenylation by binding to CPEB3 and recruiting CNOT7 which
PDB 2D5R , 2Z15 , 5CI8 , 5CI9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07742 BTG 1 112 BTG family Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHI
GEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVL
YVDDNNEN
GCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTA
TFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQP
QQQQQPAQPPPPPPPPQQQQQQKTSALSPNAKEFIFPNMQGQGSSTNGMFPGDSPLNLSP
LQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN
Sequence length 345
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  RNA degradation