Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10111
Gene name Gene Name - the full gene name approved by the HGNC.
RAD50 double strand break repair protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RAD50
Synonyms (NCBI Gene) Gene synonyms aliases
NBSLD, RAD502, hRad50
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q31.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Rad50, a protein involved in DNA double-strand break repair. This protein forms a complex with MRE11 and NBS1. The protein complex binds to DNA and displays numerous enzymatic
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs28903084 C>T Likely-benign, conflicting-interpretations-of-pathogenicity Coding sequence variant, synonymous variant
rs28903085 A>C,T Likely-benign, benign, conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
rs28903086 G>A Conflicting-interpretations-of-pathogenicity, uncertain-significance, benign Coding sequence variant, missense variant
rs28903088 G>A Conflicting-interpretations-of-pathogenicity, benign-likely-benign Coding sequence variant, missense variant
rs28903090 G>T Likely-benign, conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT721982 hsa-miR-130b-5p HITS-CLIP 19536157
MIRT721981 hsa-miR-3160-5p HITS-CLIP 19536157
MIRT721980 hsa-miR-604 HITS-CLIP 19536157
MIRT721979 hsa-miR-6762-3p HITS-CLIP 19536157
MIRT721978 hsa-miR-485-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000014 Function Single-stranded DNA endodeoxyribonuclease activity IDA 9705271
GO:0000019 Process Regulation of mitotic recombination IDA 8756642
GO:0000166 Function Nucleotide binding IEA
GO:0000722 Process Telomere maintenance via recombination IBA
GO:0000723 Process Telomere maintenance IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604040 9816 ENSG00000113522
Protein
UniProt ID Q92878
Protein name DNA repair protein RAD50 (hRAD50) (EC 3.6.-.-)
Protein function Component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis (PubMed:15064416, PubMed:21757780, PubMed:27889449, PubMed:28134932, PubMed:28867292,
PDB 5GOX
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13476 AAA_23 6 235 AAA domain Domain
PF04423 Rad50_zn_hook 659 712 Rad50 zinc hook motif Motif
PF13558 SbcCD_C 1174 1251 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed at very low level in most tissues, except in testis where it is expressed at higher level. Expressed in fibroblasts. {ECO:0000269|PubMed:8756642}.
Sequence
MSRIEKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPG
TKGNTFVHDPKVAQETDVRAQIRLQFRDVNGELIAVQRSMVCTQKSKKTEFKTLEGVITR
TKHGEKVSLSSKCAEIDREMISSLGVSKAVLNNVIFCHQEDSNWPLSEGKALKQKFDEIF
SATRYIKALETLRQVRQTQGQKVKEYQMELKYLKQYKEKACEIRDQITSKEAQLT
SSKEI
VKSYENELDPLKNRLKEIEHNLSKIMKLDNEIKALDSRKKQMEKDNSELEEKMEKVFQGT
DEQLNDLYHNHQRTVREKERKLVDCHRELEKLNKESRLLNQEKSELLVEQGRLQLQADRH
QEHIRARDSLIQSLATQLELDGFERGPFSERQIKNFHKLVRERQEGEAKTANQLMNDFAE
KETLKQKQIDEIRDKKTGLGRIIELKSEILSKKQNELKNVKYELQQLEGSSDRILELDQE
LIKAERELSKAEKNSNVETLKMEVISLQNEKADLDRTLRKLDQEMEQLNHHTTTRTQMEM
LTKDKADKDEQIRKIKSRHSDELTSLLGYFPNKKQLEDWLHSKSKEINQTRDRLAKLNKE
LASSEQNKNHINNELKRKEEQLSSYEDKLFDVCGSQDFESDLDRLKEEIEKSSKQRAMLA
GATAVYSQFITQLTDENQSCCPVCQRVFQTEAELQEVISDLQSKLRLAPDKL
KSTESELK
KKEKRRDEMLGLVPMRQSIIDLKEKEIPELRNKLQNVNRDIQRLKNDIEEQETLLGTIMP
EEESAKVCLTDVTIMERFQMELKDVERKIAQQAAKLQGIDLDRTVQQVNQEKQEKQHKLD
TVSSKIELNRKLIQDQQEQIQHLKSTTNELKSEKLQISTNLQRRQQLEEQTVELSTEVQS
LYREIKDAKEQVSPLETTLEKFQQEKEELINKKNTSNKIAQDKLNDIKEKVKNIHGYMKD
IENYIQDGKDDYKKQKETELNKVIAQLSECEKHKEKINEDMRLMRQDIDTQKIQERWLQD
NLTLRKRNEELKEVEEERKQHLKEMGQMQVLQMKSEHQKLEENIDNIKRNHNLALGRQKG
YEEEIIHFKKELREPQFRDAEEKYREMMIVMRTTELVNKDLDIYYKTLDQAIMKFHSMKM
EEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRNYNYRVVMLKGDTALDMRGR
CSAGQKVLASLIIRLALAETFCLNCGIIALDEPTTNLDRENIESLAHALVE
IIKSRSQQR
NFQLLVITHDEDFVELLGRSEYVEKFYRIKKNIDQCSEIVKCSVSSLGFNVH
Sequence length 1312
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Homologous recombination
Non-homologous end-joining
Cellular senescence
  DNA Damage/Telomere Stress Induced Senescence
HDR through Single Strand Annealing (SSA)
HDR through MMEJ (alt-NHEJ)
HDR through Homologous Recombination (HRR)
Sensing of DNA Double Strand Breaks
Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)
Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks
Resolution of D-loop Structures through Holliday Junction Intermediates
Nonhomologous End-Joining (NHEJ)
Homologous DNA Pairing and Strand Exchange
Processing of DNA double-strand break ends
Presynaptic phase of homologous DNA pairing and strand exchange
Regulation of TP53 Activity through Phosphorylation
G2/M DNA damage checkpoint
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Breast Carcinoma breast carcinoma rs142947311 N/A
Nijmegen Breakage Syndrome-Like Disorder nijmegen breakage syndrome-like disorder rs104895046, rs1554099320, rs775069541, rs1458900761, rs1561661777, rs1236278956, rs778555849, rs587780150, rs761837416, rs762648843, rs587781454, rs760146707, rs758641567, rs764968413, rs149201802
View all (68 more)
N/A
hepatocellular carcinoma Hepatocellular carcinoma rs149201802 N/A
neoplasm Neoplasm rs786203485 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma, Asthma (childhood onset), Nonatopic asthma, Asthma onset (childhood vs adult) N/A N/A GWAS
Eosinophilia Eosinophilic esophagitis N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
ovarian cancer Ovarian cancer N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 19866438
Adenocarcinoma Mucinous Associate 26705231
Adenomatous Polyposis Coli Associate 39519399
Alternating hemiplegia of childhood Associate 17693401
Arrest of spermatogenesis Associate 31983050
Asthma Associate 18846228, 20159242, 22694930, 27050946
Ataxia Telangiectasia Associate 21757780
Ataxia Telangiectasia Inhibit 9315668
Ataxia Telangiectasia Like Disorder Associate 12966088
Atherosclerosis Associate 26821299