Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1010
Gene name Gene Name - the full gene name approved by the HGNC.	Cadherin 12
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CDH12
Synonyms (NCBI Gene) Gene synonyms aliases	CDHB
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5p14.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a type II classical cadherin of the cadherin superfamily. Alternative splicing of this gene results in multiple transcript variants. At least one of these variants encodes a preproprotein that is proteolytically processed to generate the

Show/Hide all(61)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023018	hsa-miR-124-3p	Microarray	18668037
MIRT608795	hsa-miR-759	HITS-CLIP	24906430
MIRT608794	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT608793	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT608792	hsa-miR-8068	HITS-CLIP	24906430
MIRT608791	hsa-miR-6818-5p	HITS-CLIP	24906430
MIRT608790	hsa-miR-147a	HITS-CLIP	24906430
MIRT608789	hsa-miR-5010-3p	HITS-CLIP	24906430
MIRT608788	hsa-miR-4455	HITS-CLIP	24906430
MIRT608790	hsa-miR-147a	HITS-CLIP	27418678
MIRT608790	hsa-miR-147a	HITS-CLIP	27418678
MIRT608790	hsa-miR-147a	HITS-CLIP	27418678
MIRT608790	hsa-miR-147a	HITS-CLIP	27418678
MIRT608788	hsa-miR-4455	HITS-CLIP	27418678
MIRT608788	hsa-miR-4455	HITS-CLIP	27418678
MIRT608788	hsa-miR-4455	HITS-CLIP	27418678
MIRT608788	hsa-miR-4455	HITS-CLIP	27418678
MIRT608789	hsa-miR-5010-3p	HITS-CLIP	27418678
MIRT608789	hsa-miR-5010-3p	HITS-CLIP	27418678
MIRT608789	hsa-miR-5010-3p	HITS-CLIP	27418678
MIRT608789	hsa-miR-5010-3p	HITS-CLIP	27418678
MIRT608794	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608794	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608794	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608794	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608791	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT608791	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT608791	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT608791	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT608793	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608793	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608793	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608793	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608795	hsa-miR-759	HITS-CLIP	27418678
MIRT608795	hsa-miR-759	HITS-CLIP	27418678
MIRT608792	hsa-miR-8068	HITS-CLIP	27418678
MIRT608792	hsa-miR-8068	HITS-CLIP	27418678
MIRT608792	hsa-miR-8068	HITS-CLIP	27418678
MIRT608792	hsa-miR-8068	HITS-CLIP	27418678
MIRT879343	hsa-miR-129-5p	CLIP-seq
MIRT879344	hsa-miR-1302	CLIP-seq
MIRT879345	hsa-miR-3122	CLIP-seq
MIRT879346	hsa-miR-3913-5p	CLIP-seq
MIRT879347	hsa-miR-3978	CLIP-seq
MIRT879348	hsa-miR-4298	CLIP-seq
MIRT879349	hsa-miR-4777-5p	CLIP-seq
MIRT879350	hsa-miR-518d-5p	CLIP-seq
MIRT879351	hsa-miR-519b-5p	CLIP-seq
MIRT879352	hsa-miR-519c-5p	CLIP-seq
MIRT879353	hsa-miR-520c-5p	CLIP-seq
MIRT879354	hsa-miR-526a	CLIP-seq
MIRT1960650	hsa-miR-1276	CLIP-seq
MIRT1960651	hsa-miR-142-5p	CLIP-seq
MIRT1960652	hsa-miR-3125	CLIP-seq
MIRT1960653	hsa-miR-3183	CLIP-seq
MIRT1960654	hsa-miR-340	CLIP-seq
MIRT1960655	hsa-miR-3916	CLIP-seq
MIRT1960656	hsa-miR-4311	CLIP-seq
MIRT1960657	hsa-miR-4723-3p	CLIP-seq
MIRT1960658	hsa-miR-4753-3p	CLIP-seq
MIRT1960659	hsa-miR-583	CLIP-seq

Show/Hide all(18)

GO ID	Ontology	Definition	Evidence
GO:0000902	Process	Cell morphogenesis	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IBA
GO:0007043	Process	Cell-cell junction assembly	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0008013	Function	Beta-catenin binding	IBA
GO:0016020	Component	Membrane	IEA
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IBA
GO:0016342	Component	Catenin complex	IBA
GO:0016477	Process	Cell migration	IBA
GO:0034332	Process	Adherens junction organization	IBA
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	IBA
GO:0045296	Function	Cadherin binding	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0098609	Process	Cell-cell adhesion	IEA

MIM	HGNC	e!Ensembl
600562	1751	ENSG00000154162

Protein

UniProt ID

P55289

Protein name

Cadherin-12 (Brain cadherin) (BR-cadherin) (Neural type cadherin 2) (N-cadherin 2)

Protein function

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00028	Cadherin	59 → 151	Cadherin domain	Domain
PF00028	Cadherin	165 → 260	Cadherin domain	Domain
PF00028	Cadherin	274 → 376	Cadherin domain	Domain
PF00028	Cadherin	389 → 480	Cadherin domain	Domain
PF00028	Cadherin	493 → 590	Cadherin domain	Domain
PF01049	Cadherin_C	638 → 785	Cadherin cytoplasmic region	Family

Tissue specificity

TISSUE SPECIFICITY: Brain.

Sequence

MLTRNCLSLLLWVLFDGGLLTPLQPQPQQTLATEPRENVIHLPGQRSHFQRVKRGWVWNQ
FFVLEEYVGSEPQYVGKLHSDLDKGEGTVKYTLSGDGAGTVFTIDETTGDIHAIRSLDRE
EKPFYTLRAQAVDIETRKPLEPESEFIIKVQDINDNEPKFLDGPYVATVPEMSPVGAYVL
QVKATDADDPTYGNSARVVYSILQGQPYFSIDPKTGVIRTALPNMDREVKEQYQVLIQAK
DMGGQLGGLAGTTIVNITLTDVNDNPPRFPKSIFHLKVPESSPIGSAIGRIRAVDPDFGQ
NAEIEYNIVPGDGGNLFDIVTDEDTQEGVIKLKKPLDFETKKAYTFKVEASNLHLDHRFH
SAGPFKDTATVKISVLDVDEPPVFSKPLYTMEVYEDTPVGTIIGAVTAQDLDVGSSAVRY
FIDWKSDGDSYFTIDGNEGTIATNELLDRESTAQYNFSIIASKVSNPLLTSKVNILINVL
DVNEFPPEISVPYETAVCENAKPGQIIQIVSAADRDLSPAGQQFSFRLSPEAAIKPNFTV
RDFRNNTAGIETRRNGYSRRQQELYFLPVVIEDSSYPVQSSTNTMTIRVCRCDSDGTILS
CNVEAIFLPVGLSTGALIAILLCIVILLAIVVLYVALRRQKKKDTLMTSKEDIRDNVIHY
DDEGGGEEDTQAFDIGALRNPKVIEENKIRRDIKPDSLCLPRQRPPMEDNTDIRDFIHQR
LQENDVDPTAPPYDSLATYAYEGSGSVAESLSSIDSLTTEADQDYDYLTDWGPRFKVLAD
MFGEEESYNPDKVT

Sequence length

794

Interactions

View interactions

	Reactome
			Adherens junctions interactions

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Breast cancer	N/A	N/A	GWAS
Hypertension	Hypertension	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Bipolar Disorder	Associate	19567891, 21876473
Breast Neoplasms	Stimulate	36315446
Carcinoma Adenoid Cystic	Associate	24237488
Colorectal Neoplasms	Associate	24237488
Erythrokeratodermia Variabilis	Associate	31911611
Heart Defects Congenital	Associate	30342662
Hyperkeratosis Epidermolytic	Inhibit	35421402
Keratoderma Palmoplantar	Associate	31911611
Keratoderma palmoplantaris transgrediens	Associate	31911611
Muscular Atrophy Spinal	Associate	7731968
Neoplasm Metastasis	Associate	24237488, 36315446
Neoplasms	Associate	28161812, 34385456
Neoplasms Adipose Tissue	Associate	21701570
Psychomotor Disorders	Associate	23860044
Psychotic Disorders	Associate	19567891
Rumination Syndrome	Associate	30886212
Urinary Bladder Neoplasms	Associate	34385456, 35618577

CDH12 (cadherin 12)