Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10067
Gene name Gene Name - the full gene name approved by the HGNC.
Secretory carrier membrane protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SCAMP3
Synonyms (NCBI Gene) Gene synonyms aliases
C1orf3
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q22
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an integral membrane protein that belongs to the secretory carrier membrane protein family. The encoded protein functions as a carrier to the cell surface in post-golgi recycling pathways. This protein is also involved in protein traffic
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004952 hsa-let-7b-5p qRT-PCR 17942906
MIRT032041 hsa-miR-16-5p Proteomics 18668040
MIRT045441 hsa-miR-149-5p CLASH 23622248
MIRT695237 hsa-miR-320e HITS-CLIP 23313552
MIRT695236 hsa-miR-6873-5p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0006887 Process Exocytosis IBA
GO:0006892 Process Post-Golgi vesicle-mediated transport TAS 9378760
GO:0015031 Process Protein transport IEA
GO:0016020 Component Membrane IEA
GO:0031625 Function Ubiquitin protein ligase binding IPI 23418353
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606913 10565 ENSG00000116521
Protein
UniProt ID O14828
Protein name Secretory carrier-associated membrane protein 3 (Secretory carrier membrane protein 3)
Protein function Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04144 SCAMP 132 307 SCAMP family Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed, with highest expression in heart and skeletal muscle.
Sequence
MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAP
LPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRREREL
QHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLL
NFLACLASFCVETNNGAGFGLSILWVLLFTPCSFVCWYRPMYKAFRSDSSFNFFVFFFIF
FVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLMLLVALLFTGIAVLGIVMLKRI
HSLYRRT
GASFQKAQQEFAAGVFSNPAVRTAAANAAAGAAENAFRAP
Sequence length 347
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Crohn Disease Crohn's disease N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenoma Liver Cell Associate 18277965
Carcinoma Hepatocellular Associate 18277965
COVID 19 Associate 36572190
Inflammation Associate 31554889
Insulin Resistance Associate 31554889
Pancreatic Neoplasms Stimulate 33493138