Gene Gene information from NCBI Gene database.
Entrez ID 10067
Gene name Secretory carrier membrane protein 3
Gene symbol SCAMP3
Synonyms (NCBI Gene)
C1orf3
Chromosome 1
Chromosome location 1q22
Summary This gene encodes an integral membrane protein that belongs to the secretory carrier membrane protein family. The encoded protein functions as a carrier to the cell surface in post-golgi recycling pathways. This protein is also involved in protein traffic
miRNA miRNA information provided by mirtarbase database.
160
miRTarBase ID miRNA Experiments Reference
MIRT004952 hsa-let-7b-5p qRT-PCR 17942906
MIRT032041 hsa-miR-16-5p Proteomics 18668040
MIRT045441 hsa-miR-149-5p CLASH 23622248
MIRT695237 hsa-miR-320e HITS-CLIP 23313552
MIRT695236 hsa-miR-6873-5p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
GO ID Ontology Definition Evidence Reference
GO:0006887 Process Exocytosis IBA
GO:0006892 Process Post-Golgi vesicle-mediated transport TAS 9378760
GO:0015031 Process Protein transport IEA
GO:0016020 Component Membrane IEA
GO:0031625 Function Ubiquitin protein ligase binding IPI 23418353
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606913 10565 ENSG00000116521
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O14828
Protein name Secretory carrier-associated membrane protein 3 (Secretory carrier membrane protein 3)
Protein function Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04144 SCAMP 132 307 SCAMP family Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed, with highest expression in heart and skeletal muscle.
Sequence
MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAP
LPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRREREL
QHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLL
NFLACLASFCVETNNGAGFGLSILWVLLFTPCSFVCWYRPMYKAFRSDSSFNFFVFFFIF
FVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLMLLVALLFTGIAVLGIVMLKRI
HSLYRRT
GASFQKAQQEFAAGVFSNPAVRTAAANAAAGAAENAFRAP
Sequence length 347
Interactions View interactions