SCAMP2 (secretory carrier membrane protein 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10066
Gene name Gene Name - the full gene name approved by the HGNC.
Secretory carrier membrane protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SCAMP2
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q24.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene product belongs to the SCAMP family of proteins which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(187)
miRTarBase ID miRNA Experiments Reference
MIRT020269 hsa-miR-130b-3p Sequencing 20371350
MIRT023203 hsa-miR-124-3p Microarray 18668037
MIRT025921 hsa-miR-7-5p Microarray 19073608
MIRT050416 hsa-miR-23a-3p CLASH 23622248
MIRT037485 hsa-miR-744-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(16)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 15840657, 16870614, 19276089, 32296183, 32814053
GO:0005768 Component Endosome IEA
GO:0005794 Component Golgi apparatus IDA
GO:0005794 Component Golgi apparatus IEA
GO:0006887 Process Exocytosis IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
606912 10564 ENSG00000140497
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID O15127
Protein name Secretory carrier-associated membrane protein 2 (Secretory carrier membrane protein 2)
Protein function Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04144 SCAMP 117 → 293 SCAMP family Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed.
Sequence 
MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQP
AVLQPSVEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNW
PPLPSWCPVKPCFYQDFSTEIPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSK
GVDFGLSILWFLIFTPCAFLCWYRPIYKAFRSDNSFSFFVFFFVFFCQIGIYIIQLVGIP
GLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSVFLLQRVHSLYRRTGASFQQA
QEEFSQGIFSSRTFHRAASSAAQGAFQGN
Sequence length 329
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast cancer Breast cancer, Breast cancer (estrogen-receptor positive) N/A N/A GWAS
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Show/Hide Text Mining Associations (4)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinogenesis Associate 34426610
Leukemia Myeloid Acute Associate 34426610
Leukemia T Cell Associate 34426610
Pancreatic Neoplasms Stimulate 33493138