Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10059
Gene name	Dynamin 1 like
Gene symbol	DNM1L
Synonyms (NCBI Gene)	DLP1DRP1DVLPDYMPLEEMPFEMPF1HDYNIVOPA5
Chromosome	12
Chromosome location	12p11.21
Summary	This gene encodes a member of the dynamin superfamily of GTPases. The encoded protein mediates mitochondrial and peroxisomal division, and is involved in developmentally regulated apoptosis and programmed necrosis. Dysfunction of this gene is implicated i

Show/Hide all (10)

SNP ID	Visualize variation	Clinical significance	Consequence
rs745921568	A>T	Likely-pathogenic	Coding sequence variant, stop gained, 5 prime UTR variant
rs879255686	->A	Pathogenic	Coding sequence variant, intron variant, frameshift variant
rs879255687	GA>-	Pathogenic	5 prime UTR variant, coding sequence variant, intron variant, frameshift variant
rs879255688	A>G	Pathogenic	5 prime UTR variant, coding sequence variant, missense variant
rs1057523007	G>C	Likely-pathogenic	5 prime UTR variant, missense variant, coding sequence variant
rs1057523861	G>A	Likely-pathogenic	Intron variant, 5 prime UTR variant, missense variant, coding sequence variant
rs1555119216	C>A	Pathogenic	Missense variant, coding sequence variant, intron variant
rs1555229948	A>C	Pathogenic	Missense variant, 5 prime UTR variant, coding sequence variant
rs1555229978	AACA>CACT	Likely-pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs1592631789	->AA	Pathogenic	Coding sequence variant, frameshift variant

379

Show/Hide all (379)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050255	hsa-miR-25-3p	CLASH	23622248
MIRT039911	hsa-miR-615-3p	CLASH	23622248
MIRT134280	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT134275	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT134280	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT134274	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT134283	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT134276	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT134288	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT134275	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT731893	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	28347692
MIRT731893	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	28347692
MIRT731893	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	28347692
MIRT731893	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	28347692
MIRT942272	hsa-miR-125a-3p	CLIP-seq
MIRT942273	hsa-miR-130a	CLIP-seq
MIRT942274	hsa-miR-130b	CLIP-seq
MIRT942275	hsa-miR-150	CLIP-seq
MIRT942276	hsa-miR-1912	CLIP-seq
MIRT942277	hsa-miR-19a	CLIP-seq
MIRT942278	hsa-miR-19b	CLIP-seq
MIRT942279	hsa-miR-21	CLIP-seq
MIRT942280	hsa-miR-301a	CLIP-seq
MIRT942281	hsa-miR-301b	CLIP-seq
MIRT942282	hsa-miR-330-3p	CLIP-seq
MIRT942283	hsa-miR-3666	CLIP-seq
MIRT942284	hsa-miR-3713	CLIP-seq
MIRT942285	hsa-miR-3923	CLIP-seq
MIRT942286	hsa-miR-3934	CLIP-seq
MIRT942287	hsa-miR-4295	CLIP-seq
MIRT942288	hsa-miR-4426	CLIP-seq
MIRT942289	hsa-miR-4528	CLIP-seq
MIRT942290	hsa-miR-454	CLIP-seq
MIRT942291	hsa-miR-4647	CLIP-seq
MIRT942292	hsa-miR-4662b	CLIP-seq
MIRT942293	hsa-miR-4671-3p	CLIP-seq
MIRT942294	hsa-miR-4694-3p	CLIP-seq
MIRT942295	hsa-miR-4775	CLIP-seq
MIRT942296	hsa-miR-515-5p	CLIP-seq
MIRT942297	hsa-miR-586	CLIP-seq
MIRT942298	hsa-miR-590-5p	CLIP-seq
MIRT942299	hsa-miR-607	CLIP-seq
MIRT942300	hsa-miR-640	CLIP-seq
MIRT942301	hsa-miR-711	CLIP-seq
MIRT942302	hsa-miR-764	CLIP-seq
MIRT942272	hsa-miR-125a-3p	CLIP-seq
MIRT942275	hsa-miR-150	CLIP-seq
MIRT942303	hsa-miR-3149	CLIP-seq
MIRT942304	hsa-miR-34a	CLIP-seq
MIRT942305	hsa-miR-34c-5p	CLIP-seq
MIRT942306	hsa-miR-3620	CLIP-seq
MIRT942307	hsa-miR-3913-3p	CLIP-seq
MIRT942286	hsa-miR-3934	CLIP-seq
MIRT942308	hsa-miR-4326	CLIP-seq
MIRT942309	hsa-miR-4433	CLIP-seq
MIRT942310	hsa-miR-4438	CLIP-seq
MIRT942311	hsa-miR-4468	CLIP-seq
MIRT942312	hsa-miR-449a	CLIP-seq
MIRT942313	hsa-miR-449b	CLIP-seq
MIRT942314	hsa-miR-4672	CLIP-seq
MIRT942315	hsa-miR-4676-5p	CLIP-seq
MIRT942316	hsa-miR-4710	CLIP-seq
MIRT942317	hsa-miR-4720-3p	CLIP-seq
MIRT942318	hsa-miR-4738-3p	CLIP-seq
MIRT942319	hsa-miR-4740-3p	CLIP-seq
MIRT942295	hsa-miR-4775	CLIP-seq
MIRT942320	hsa-miR-4787-3p	CLIP-seq
MIRT942321	hsa-miR-4790-3p	CLIP-seq
MIRT942322	hsa-miR-4792	CLIP-seq
MIRT942323	hsa-miR-4804-3p	CLIP-seq
MIRT942324	hsa-miR-485-3p	CLIP-seq
MIRT942325	hsa-miR-489	CLIP-seq
MIRT942326	hsa-miR-5095	CLIP-seq
MIRT942327	hsa-miR-514	CLIP-seq
MIRT942328	hsa-miR-514b-3p	CLIP-seq
MIRT942329	hsa-miR-561	CLIP-seq
MIRT942330	hsa-miR-575	CLIP-seq
MIRT942331	hsa-miR-590-3p	CLIP-seq
MIRT942332	hsa-miR-595	CLIP-seq
MIRT942300	hsa-miR-640	CLIP-seq
MIRT942302	hsa-miR-764	CLIP-seq
MIRT942272	hsa-miR-125a-3p	CLIP-seq
MIRT942275	hsa-miR-150	CLIP-seq
MIRT942333	hsa-miR-1976	CLIP-seq
MIRT942334	hsa-miR-2052	CLIP-seq
MIRT942335	hsa-miR-2682	CLIP-seq
MIRT942336	hsa-miR-3591-5p	CLIP-seq
MIRT942306	hsa-miR-3620	CLIP-seq
MIRT942286	hsa-miR-3934	CLIP-seq
MIRT942337	hsa-miR-4279	CLIP-seq
MIRT942338	hsa-miR-449c	CLIP-seq
MIRT942339	hsa-miR-451b	CLIP-seq
MIRT942340	hsa-miR-4722-3p	CLIP-seq
MIRT942319	hsa-miR-4740-3p	CLIP-seq
MIRT942324	hsa-miR-485-3p	CLIP-seq
MIRT942341	hsa-miR-510	CLIP-seq
MIRT942342	hsa-miR-512-5p	CLIP-seq
MIRT942343	hsa-miR-616	CLIP-seq
MIRT942344	hsa-miR-627	CLIP-seq
MIRT942300	hsa-miR-640	CLIP-seq
MIRT942302	hsa-miR-764	CLIP-seq
MIRT942345	hsa-miR-940	CLIP-seq
MIRT1978988	hsa-miR-3973	CLIP-seq
MIRT942324	hsa-miR-485-3p	CLIP-seq
MIRT942331	hsa-miR-590-3p	CLIP-seq
MIRT942343	hsa-miR-616	CLIP-seq
MIRT942314	hsa-miR-4672	CLIP-seq
MIRT942295	hsa-miR-4775	CLIP-seq
MIRT2214129	hsa-miR-499a-5p	CLIP-seq
MIRT2214130	hsa-miR-122	CLIP-seq
MIRT942272	hsa-miR-125a-3p	CLIP-seq
MIRT942273	hsa-miR-130a	CLIP-seq
MIRT942274	hsa-miR-130b	CLIP-seq
MIRT2214131	hsa-miR-136	CLIP-seq
MIRT942275	hsa-miR-150	CLIP-seq
MIRT2214132	hsa-miR-183	CLIP-seq
MIRT942280	hsa-miR-301a	CLIP-seq
MIRT942281	hsa-miR-301b	CLIP-seq
MIRT2214133	hsa-miR-3074-5p	CLIP-seq
MIRT2214134	hsa-miR-3135b	CLIP-seq
MIRT2214135	hsa-miR-3160-5p	CLIP-seq
MIRT2214136	hsa-miR-320e	CLIP-seq
MIRT2214137	hsa-miR-3651	CLIP-seq
MIRT2214138	hsa-miR-3652	CLIP-seq
MIRT2214139	hsa-miR-3663-5p	CLIP-seq
MIRT942283	hsa-miR-3666	CLIP-seq
MIRT2214140	hsa-miR-370	CLIP-seq
MIRT942286	hsa-miR-3934	CLIP-seq
MIRT942287	hsa-miR-4295	CLIP-seq
MIRT2214141	hsa-miR-4423-5p	CLIP-seq
MIRT2214142	hsa-miR-4430	CLIP-seq
MIRT942311	hsa-miR-4468	CLIP-seq
MIRT2214143	hsa-miR-4480	CLIP-seq
MIRT942290	hsa-miR-454	CLIP-seq
MIRT942314	hsa-miR-4672	CLIP-seq
MIRT942315	hsa-miR-4676-5p	CLIP-seq
MIRT2214144	hsa-miR-4716-5p	CLIP-seq
MIRT2214145	hsa-miR-4781-3p	CLIP-seq
MIRT942324	hsa-miR-485-3p	CLIP-seq
MIRT942296	hsa-miR-515-5p	CLIP-seq
MIRT2214146	hsa-miR-564	CLIP-seq
MIRT942330	hsa-miR-575	CLIP-seq
MIRT942302	hsa-miR-764	CLIP-seq
MIRT942310	hsa-miR-4438	CLIP-seq
MIRT942326	hsa-miR-5095	CLIP-seq
MIRT2518434	hsa-miR-106a	CLIP-seq
MIRT2518435	hsa-miR-106b	CLIP-seq
MIRT2518436	hsa-miR-1227	CLIP-seq
MIRT2518437	hsa-miR-1234	CLIP-seq
MIRT942272	hsa-miR-125a-3p	CLIP-seq
MIRT2518438	hsa-miR-1262	CLIP-seq
MIRT2518439	hsa-miR-1278	CLIP-seq
MIRT2518440	hsa-miR-129-5p	CLIP-seq
MIRT2518441	hsa-miR-1303	CLIP-seq
MIRT2518442	hsa-miR-1468	CLIP-seq
MIRT942275	hsa-miR-150	CLIP-seq
MIRT2518443	hsa-miR-17	CLIP-seq
MIRT2518444	hsa-miR-20a	CLIP-seq
MIRT2518445	hsa-miR-20b	CLIP-seq
MIRT2518446	hsa-miR-2276	CLIP-seq
MIRT2518447	hsa-miR-302a	CLIP-seq
MIRT2518448	hsa-miR-302b	CLIP-seq
MIRT2518449	hsa-miR-302c	CLIP-seq
MIRT2518450	hsa-miR-302d	CLIP-seq
MIRT2518451	hsa-miR-302e	CLIP-seq
MIRT2518452	hsa-miR-3065-5p	CLIP-seq
MIRT2518453	hsa-miR-3119	CLIP-seq
MIRT2518454	hsa-miR-3124-3p	CLIP-seq
MIRT942303	hsa-miR-3149	CLIP-seq
MIRT2518455	hsa-miR-3152-5p	CLIP-seq
MIRT2518456	hsa-miR-3153	CLIP-seq
MIRT2518457	hsa-miR-3167	CLIP-seq
MIRT2518458	hsa-miR-3171	CLIP-seq
MIRT2518459	hsa-miR-3189-3p	CLIP-seq
MIRT2518460	hsa-miR-3613-5p	CLIP-seq
MIRT2518461	hsa-miR-3673	CLIP-seq
MIRT2518462	hsa-miR-372	CLIP-seq
MIRT2518463	hsa-miR-373	CLIP-seq
MIRT942307	hsa-miR-3913-3p	CLIP-seq
MIRT2518464	hsa-miR-3925-3p	CLIP-seq
MIRT942286	hsa-miR-3934	CLIP-seq
MIRT2518465	hsa-miR-411	CLIP-seq
MIRT2518466	hsa-miR-4263	CLIP-seq
MIRT2518467	hsa-miR-4268	CLIP-seq
MIRT942308	hsa-miR-4326	CLIP-seq
MIRT2518468	hsa-miR-4328	CLIP-seq
MIRT942310	hsa-miR-4438	CLIP-seq
MIRT2518469	hsa-miR-4455	CLIP-seq
MIRT2518470	hsa-miR-4457	CLIP-seq
MIRT2518471	hsa-miR-4476	CLIP-seq
MIRT2518472	hsa-miR-4477b	CLIP-seq
MIRT2518473	hsa-miR-4489	CLIP-seq
MIRT2518474	hsa-miR-4508	CLIP-seq
MIRT942339	hsa-miR-451b	CLIP-seq
MIRT2518475	hsa-miR-4646-5p	CLIP-seq
MIRT2518476	hsa-miR-4661-5p	CLIP-seq
MIRT2518477	hsa-miR-4668-5p	CLIP-seq
MIRT2518478	hsa-miR-4686	CLIP-seq
MIRT2518479	hsa-miR-4691-5p	CLIP-seq
MIRT2518480	hsa-miR-4701-3p	CLIP-seq
MIRT942316	hsa-miR-4710	CLIP-seq
MIRT2518481	hsa-miR-4712-5p	CLIP-seq
MIRT2518482	hsa-miR-4715-3p	CLIP-seq
MIRT2518483	hsa-miR-4729	CLIP-seq
MIRT2518484	hsa-miR-4731-5p	CLIP-seq
MIRT2518485	hsa-miR-4753-3p	CLIP-seq
MIRT2518486	hsa-miR-4768-5p	CLIP-seq
MIRT2518487	hsa-miR-4772-3p	CLIP-seq
MIRT942322	hsa-miR-4792	CLIP-seq
MIRT2518488	hsa-miR-4795-3p	CLIP-seq
MIRT2518489	hsa-miR-4796-5p	CLIP-seq
MIRT2518490	hsa-miR-483-5p	CLIP-seq
MIRT942324	hsa-miR-485-3p	CLIP-seq
MIRT942325	hsa-miR-489	CLIP-seq
MIRT2214129	hsa-miR-499a-5p	CLIP-seq
MIRT942326	hsa-miR-5095	CLIP-seq
MIRT2518491	hsa-miR-512-3p	CLIP-seq
MIRT2518492	hsa-miR-513b	CLIP-seq
MIRT2518493	hsa-miR-519a	CLIP-seq
MIRT2518494	hsa-miR-519b-3p	CLIP-seq
MIRT2518495	hsa-miR-519c-3p	CLIP-seq
MIRT2518496	hsa-miR-519d	CLIP-seq
MIRT2518497	hsa-miR-520a-3p	CLIP-seq
MIRT2518498	hsa-miR-520b	CLIP-seq
MIRT2518499	hsa-miR-520c-3p	CLIP-seq
MIRT2518500	hsa-miR-520d-3p	CLIP-seq
MIRT2518501	hsa-miR-520d-5p	CLIP-seq
MIRT2518502	hsa-miR-520e	CLIP-seq
MIRT2518503	hsa-miR-520g	CLIP-seq
MIRT2518504	hsa-miR-520h	CLIP-seq
MIRT2518505	hsa-miR-524-5p	CLIP-seq
MIRT2518506	hsa-miR-544	CLIP-seq
MIRT2518507	hsa-miR-548a-5p	CLIP-seq
MIRT2518508	hsa-miR-548ab	CLIP-seq
MIRT2518509	hsa-miR-548ak	CLIP-seq
MIRT2518510	hsa-miR-548b-5p	CLIP-seq
MIRT2518511	hsa-miR-548c-5p	CLIP-seq
MIRT2518512	hsa-miR-548d-5p	CLIP-seq
MIRT2518513	hsa-miR-548h	CLIP-seq
MIRT2518514	hsa-miR-548i	CLIP-seq
MIRT2518515	hsa-miR-548j	CLIP-seq
MIRT2518516	hsa-miR-548n	CLIP-seq
MIRT2518517	hsa-miR-548w	CLIP-seq
MIRT2518518	hsa-miR-548y	CLIP-seq
MIRT2518519	hsa-miR-559	CLIP-seq
MIRT2518520	hsa-miR-576-3p	CLIP-seq
MIRT2518521	hsa-miR-576-5p	CLIP-seq
MIRT2518522	hsa-miR-578	CLIP-seq
MIRT942332	hsa-miR-595	CLIP-seq
MIRT2518523	hsa-miR-609	CLIP-seq
MIRT942300	hsa-miR-640	CLIP-seq
MIRT942302	hsa-miR-764	CLIP-seq
MIRT2518524	hsa-miR-770-5p	CLIP-seq
MIRT2518525	hsa-miR-876-5p	CLIP-seq
MIRT2518526	hsa-miR-889	CLIP-seq
MIRT2518527	hsa-miR-93	CLIP-seq
MIRT2518434	hsa-miR-106a	CLIP-seq
MIRT2518435	hsa-miR-106b	CLIP-seq
MIRT2518436	hsa-miR-1227	CLIP-seq
MIRT2518437	hsa-miR-1234	CLIP-seq
MIRT942272	hsa-miR-125a-3p	CLIP-seq
MIRT2518438	hsa-miR-1262	CLIP-seq
MIRT2679363	hsa-miR-127-5p	CLIP-seq
MIRT2518439	hsa-miR-1278	CLIP-seq
MIRT2679364	hsa-miR-1279	CLIP-seq
MIRT2518440	hsa-miR-129-5p	CLIP-seq
MIRT2518441	hsa-miR-1303	CLIP-seq
MIRT2214131	hsa-miR-136	CLIP-seq
MIRT2518442	hsa-miR-1468	CLIP-seq
MIRT942275	hsa-miR-150	CLIP-seq
MIRT2518443	hsa-miR-17	CLIP-seq
MIRT2518444	hsa-miR-20a	CLIP-seq
MIRT2518445	hsa-miR-20b	CLIP-seq
MIRT2518446	hsa-miR-2276	CLIP-seq
MIRT2518447	hsa-miR-302a	CLIP-seq
MIRT2518448	hsa-miR-302b	CLIP-seq
MIRT2518449	hsa-miR-302c	CLIP-seq
MIRT2518450	hsa-miR-302d	CLIP-seq
MIRT2518451	hsa-miR-302e	CLIP-seq
MIRT2518452	hsa-miR-3065-5p	CLIP-seq
MIRT2518453	hsa-miR-3119	CLIP-seq
MIRT2518454	hsa-miR-3124-3p	CLIP-seq
MIRT2679365	hsa-miR-3143	CLIP-seq
MIRT942303	hsa-miR-3149	CLIP-seq
MIRT2518455	hsa-miR-3152-5p	CLIP-seq
MIRT2518456	hsa-miR-3153	CLIP-seq
MIRT2518457	hsa-miR-3167	CLIP-seq
MIRT2518458	hsa-miR-3171	CLIP-seq
MIRT2518459	hsa-miR-3189-3p	CLIP-seq
MIRT2518460	hsa-miR-3613-5p	CLIP-seq
MIRT2518461	hsa-miR-3673	CLIP-seq
MIRT2518462	hsa-miR-372	CLIP-seq
MIRT2518463	hsa-miR-373	CLIP-seq
MIRT942307	hsa-miR-3913-3p	CLIP-seq
MIRT2518464	hsa-miR-3925-3p	CLIP-seq
MIRT942286	hsa-miR-3934	CLIP-seq
MIRT2518465	hsa-miR-411	CLIP-seq
MIRT2518466	hsa-miR-4263	CLIP-seq
MIRT2518467	hsa-miR-4268	CLIP-seq
MIRT942308	hsa-miR-4326	CLIP-seq
MIRT2518468	hsa-miR-4328	CLIP-seq
MIRT942310	hsa-miR-4438	CLIP-seq
MIRT2679366	hsa-miR-4446-5p	CLIP-seq
MIRT2518469	hsa-miR-4455	CLIP-seq
MIRT2518470	hsa-miR-4457	CLIP-seq
MIRT2518471	hsa-miR-4476	CLIP-seq
MIRT2518472	hsa-miR-4477b	CLIP-seq
MIRT2518473	hsa-miR-4489	CLIP-seq
MIRT2518474	hsa-miR-4508	CLIP-seq
MIRT942339	hsa-miR-451b	CLIP-seq
MIRT2518475	hsa-miR-4646-5p	CLIP-seq
MIRT2518476	hsa-miR-4661-5p	CLIP-seq
MIRT2518477	hsa-miR-4668-5p	CLIP-seq
MIRT2518478	hsa-miR-4686	CLIP-seq
MIRT2518479	hsa-miR-4691-5p	CLIP-seq
MIRT2518480	hsa-miR-4701-3p	CLIP-seq
MIRT942316	hsa-miR-4710	CLIP-seq
MIRT2518481	hsa-miR-4712-5p	CLIP-seq
MIRT2518482	hsa-miR-4715-3p	CLIP-seq
MIRT2518483	hsa-miR-4729	CLIP-seq
MIRT2518484	hsa-miR-4731-5p	CLIP-seq
MIRT2518485	hsa-miR-4753-3p	CLIP-seq
MIRT2679367	hsa-miR-4755-5p	CLIP-seq
MIRT2518486	hsa-miR-4768-5p	CLIP-seq
MIRT2518487	hsa-miR-4772-3p	CLIP-seq
MIRT942322	hsa-miR-4792	CLIP-seq
MIRT2518488	hsa-miR-4795-3p	CLIP-seq
MIRT2518489	hsa-miR-4796-5p	CLIP-seq
MIRT2679368	hsa-miR-4803	CLIP-seq
MIRT2518490	hsa-miR-483-5p	CLIP-seq
MIRT942324	hsa-miR-485-3p	CLIP-seq
MIRT2214129	hsa-miR-499a-5p	CLIP-seq
MIRT942326	hsa-miR-5095	CLIP-seq
MIRT2679369	hsa-miR-511	CLIP-seq
MIRT2518491	hsa-miR-512-3p	CLIP-seq
MIRT2518492	hsa-miR-513b	CLIP-seq
MIRT942296	hsa-miR-515-5p	CLIP-seq
MIRT2518493	hsa-miR-519a	CLIP-seq
MIRT2518494	hsa-miR-519b-3p	CLIP-seq
MIRT2518495	hsa-miR-519c-3p	CLIP-seq
MIRT2518496	hsa-miR-519d	CLIP-seq
MIRT2518497	hsa-miR-520a-3p	CLIP-seq
MIRT2518498	hsa-miR-520b	CLIP-seq
MIRT2518499	hsa-miR-520c-3p	CLIP-seq
MIRT2518500	hsa-miR-520d-3p	CLIP-seq
MIRT2518501	hsa-miR-520d-5p	CLIP-seq
MIRT2518502	hsa-miR-520e	CLIP-seq
MIRT2518503	hsa-miR-520g	CLIP-seq
MIRT2518504	hsa-miR-520h	CLIP-seq
MIRT2518505	hsa-miR-524-5p	CLIP-seq
MIRT2518506	hsa-miR-544	CLIP-seq
MIRT2518507	hsa-miR-548a-5p	CLIP-seq
MIRT2518508	hsa-miR-548ab	CLIP-seq
MIRT2518509	hsa-miR-548ak	CLIP-seq
MIRT2518510	hsa-miR-548b-5p	CLIP-seq
MIRT2518511	hsa-miR-548c-5p	CLIP-seq
MIRT2518512	hsa-miR-548d-5p	CLIP-seq
MIRT2518513	hsa-miR-548h	CLIP-seq
MIRT2518514	hsa-miR-548i	CLIP-seq
MIRT2518515	hsa-miR-548j	CLIP-seq
MIRT2518516	hsa-miR-548n	CLIP-seq
MIRT2679370	hsa-miR-548p	CLIP-seq
MIRT2518517	hsa-miR-548w	CLIP-seq
MIRT2518518	hsa-miR-548y	CLIP-seq
MIRT2518519	hsa-miR-559	CLIP-seq
MIRT2679371	hsa-miR-562	CLIP-seq
MIRT2518520	hsa-miR-576-3p	CLIP-seq
MIRT2518521	hsa-miR-576-5p	CLIP-seq
MIRT2518522	hsa-miR-578	CLIP-seq
MIRT942332	hsa-miR-595	CLIP-seq
MIRT2518523	hsa-miR-609	CLIP-seq
MIRT942300	hsa-miR-640	CLIP-seq
MIRT2679372	hsa-miR-664	CLIP-seq
MIRT2679373	hsa-miR-670	CLIP-seq
MIRT942302	hsa-miR-764	CLIP-seq
MIRT2518524	hsa-miR-770-5p	CLIP-seq
MIRT2518525	hsa-miR-876-5p	CLIP-seq
MIRT2518526	hsa-miR-889	CLIP-seq
MIRT2518527	hsa-miR-93	CLIP-seq

Show/Hide all (98)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000266	Process	Mitochondrial fission	IBA
GO:0000266	Process	Mitochondrial fission	IDA	20850011, 23530241
GO:0000266	Process	Mitochondrial fission	IEA
GO:0000266	Process	Mitochondrial fission	IMP	23349293
GO:0000266	Process	Mitochondrial fission	IMP	18353969, 21149567, 22265414, 23921378, 26992161, 27145208, 32484300
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	22265414, 23530241
GO:0003924	Function	GTPase activity	IEA
GO:0005096	Function	GTPase activator activity	IC	25767741
GO:0005515	Function	Protein binding	IPI	9731200, 12861026, 18838687, 19638400, 21149567, 21217774, 21508961, 21701560, 21822277, 22228096, 22367970, 22639965, 23283981, 23813973, 24282027, 24550280, 26358295, 26618722, 27059175, 29464060, 29541021, 30914652, 31046837, 32814053
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12618434, 21149567, 23349293
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IMP	28969390
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	11514614, 21822277, 22265414, 23349293, 23530241, 23921378, 24599962, 26618722, 29307555
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	IMP	28969390
GO:0005741	Component	Mitochondrial outer membrane	IDA	21149567, 26122121, 27145208
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005777	Component	Peroxisome	IDA	12618434
GO:0005777	Component	Peroxisome	IEA
GO:0005777	Component	Peroxisome	IMP	23921378
GO:0005783	Component	Endoplasmic reticulum	IDA	11514614
GO:0005783	Component	Endoplasmic reticulum	IDA	9472031
GO:0005789	Component	Endoplasmic reticulum membrane	TAS	25767741
GO:0005794	Component	Golgi apparatus	IDA	20688057
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA	22265414, 23921378
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	IMP	11514614
GO:0005829	Component	Cytosol	TAS
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IDA	9472031
GO:0005874	Component	Microtubule	IDA	21525035
GO:0005903	Component	Brush border	IEA
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006897	Process	Endocytosis	IEA
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007005	Process	Mitochondrion organization	IMP	21149567
GO:0007005	Process	Mitochondrion organization	IMP	11514614
GO:0007029	Process	Endoplasmic reticulum organization	IMP	11514614
GO:0008017	Function	Microtubule binding	IBA
GO:0008289	Function	Lipid binding	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010821	Process	Regulation of mitochondrion organization	IEA
GO:0012501	Process	Programmed cell death	IEA
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016559	Process	Peroxisome fission	IBA
GO:0016559	Process	Peroxisome fission	IDA	12618434
GO:0016559	Process	Peroxisome fission	IEA
GO:0016559	Process	Peroxisome fission	IMP	18353969, 23921378
GO:0016787	Function	Hydrolase activity	IEA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0030742	Function	GTP-dependent protein binding	IDA	25767741
GO:0031267	Function	Small GTPase binding	IDA	25767741
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	16874301, 19407830
GO:0032991	Component	Protein-containing complex	IDA	17408615, 18353969
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	18353969, 20850011, 21701560, 23584531, 29899447, 30914652
GO:0042803	Function	Protein homodimerization activity	IDA	22265414, 23530241
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0043653	Process	Mitochondrial fragmentation involved in apoptotic process	IBA
GO:0043653	Process	Mitochondrial fragmentation involved in apoptotic process	IEA
GO:0043653	Process	Mitochondrial fragmentation involved in apoptotic process	IMP	12499352
GO:0045202	Component	Synapse	IEA
GO:0048312	Process	Intracellular distribution of mitochondria	IBA
GO:0048312	Process	Intracellular distribution of mitochondria	IEA
GO:0048312	Process	Intracellular distribution of mitochondria	IMP	11514614
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	9472031, 9570752
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0050714	Process	Positive regulation of protein secretion	IDA	9570752
GO:0051259	Process	Protein complex oligomerization	IMP	27145208
GO:0060047	Process	Heart contraction	IEA
GO:0070585	Process	Protein localization to mitochondrion	IEA
GO:0070585	Process	Protein localization to mitochondrion	IMP	23584531
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IMP	28388446
GO:0090141	Process	Positive regulation of mitochondrial fission	IEA
GO:0090141	Process	Positive regulation of mitochondrial fission	IMP	19279012
GO:0090141	Process	Positive regulation of mitochondrial fission	TAS	20436456
GO:0090149	Process	Mitochondrial membrane fission	IDA	11514614
GO:0090149	Process	Mitochondrial membrane fission	IMP	21822277, 27301544, 27328748
GO:0099073	Component	Mitochondrion-derived vesicle	IDA	26618722
GO:0160040	Process	Mitocytosis	IEA
GO:1900063	Process	Regulation of peroxisome organization	IEA
GO:1901524	Process	Regulation of mitophagy	IGI	19279012
GO:1903532	Process	Positive regulation of secretion by cell	IEA
GO:1903578	Process	Regulation of ATP metabolic process	IEA

MIM	HGNC	e!Ensembl
603850	2973	ENSG00000087470

O00429

Protein name

Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1

Protein function

Functions in mitochondrial and peroxisomal division (PubMed:11514614, PubMed:12499366, PubMed:17301055, PubMed:17460227, PubMed:17553808, PubMed:18695047, PubMed:18838687, PubMed:19342591, PubMed:19411255, PubMed:19638400, PubMed:23283981, PubMe

PDB

3W6N , 3W6O , 3W6P , 4BEJ , 4H1U , 4H1V , 5WP9 , 8T1H

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00350	Dynamin_N	28 → 217	Dynamin family	Domain
PF01031	Dynamin_M	226 → 510	Dynamin central region	Family
PF02212	GED	639 → 730	Dynamin GTPase effector domain	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed with highest levels found in skeletal muscles, heart, kidney and brain. Isoform 1 is brain-specific. Isoform 2 and isoform 3 are predominantly expressed in testis and skeletal muscles respectively. Isoform 4 is w

Sequence

MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTR
RPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISG
NNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSI
ILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLG
IIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDC
LPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSEL
CGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQ
IKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTN
EMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSAL
APASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEE
LLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRK
NIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKAL
QGASQIIAEIRETHLW

Sequence length

736

Interactions

View interactions

	KEGG		Reactome
	Necroptosis NOD-like receptor signaling pathway TNF signaling pathway		Apoptotic execution phase

123

Show/Hide Causal Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
DNM1L-related disorder	Likely pathogenic; Pathogenic	rs1316999302, rs2540980636, rs886037861	RCV004545826 RCV004545842 RCV003897583
DNM1L-related movement disorder	Likely pathogenic	rs2137612089	RCV001598695
Encephalopathy, lethal, due to defective mitochondrial peroxisomal fission 1	Pathogenic; Likely pathogenic	rs2137302207, rs2137523446, rs769684495, rs201259747, rs2541080714, rs2541008031, rs121908531, rs863223953, rs2540980636, rs879253874, rs879255685, rs886037861, rs879255686, rs879255687, rs1952694899 View all (9 more)	RCV001827471 RCV001775395 RCV002507784 RCV005868536 RCV002466320 RCV002468699 RCV000006386 RCV000239677 RCV005254685 RCV000237095 RCV000239637 RCV000239681 RCV000239719 RCV000239652 RCV003225605 RCV003479513 RCV003479514 RCV003314424 RCV003335822 RCV000414839 RCV000757997 RCV000850504 RCV000988806 RCV001251095 RCV001253719 RCV001271120
Mitochondrial disease	Likely pathogenic	rs1316999302, rs2137520923, rs2137612346	RCV002221285 RCV002221286 RCV002221288
Optic atrophy 5	Likely pathogenic; Pathogenic	rs769684495, rs863223953, rs1064794656, rs1555229948, rs1555119216, rs1565548029, rs1592631789	RCV002507784 RCV000850522 RCV002248701 RCV000515453 RCV000515455 RCV000850546 RCV000850504

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs7302961	RCV005905661
Familial cancer of breast	Conflicting classifications of pathogenicity	rs138133550	RCV005893493
Hereditary ataxia	Likely benign	rs555040961	RCV005626604
Hereditary spastic paraplegia 8	Uncertain significance	rs762401850	RCV000785088
Lethal Encephalopathy	Likely benign; Uncertain significance	rs768493019, rs190574893, rs1555133474, rs758547863, rs781178788, rs568956138, rs886049302, rs34421401, rs376738847, rs143037211, rs370524523, rs140265365	RCV000305588 RCV000337535 RCV000408029 RCV000315022 RCV000289448 RCV000344382 RCV000262136 RCV000277306 RCV000405929 RCV000331916 RCV000376995 RCV000377771
Malignant tumor of urinary bladder	Uncertain significance	rs746168549	RCV005923960
Obesity	Conflicting classifications of pathogenicity	rs745921568	RCV000787973
Ovarian serous cystadenocarcinoma	Benign	rs7302961	RCV005905663
Retinal dystrophy	Uncertain significance	rs745309773	RCV004816737
Sarcoma	Benign	rs7302961	RCV005905662
See cases	Conflicting classifications of pathogenicity	rs149256584, rs374173514	RCV002252764 RCV002252760
Uterine corpus endometrial carcinoma	Benign	rs7302961	RCV005905664

Show/Hide Text Mining Associations (88)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acidosis Lactic	Associate	27328748
Adenocarcinoma of Lung	Associate	19525928, 31770286
AIDS Associated Nephropathy	Associate	32276639
Allanson Pantzar McLeod syndrome	Associate	26604000
Alzheimer Disease	Inhibit	18599615, 30171839
Alzheimer Disease	Associate	24252614, 26122121, 32216003
Ataxia Telangiectasia	Associate	27831567
Atherosclerosis	Associate	37315759
Brain Diseases	Associate	26604000, 30850373, 31475481, 34573276
Breast Neoplasms	Stimulate	23128392
Breast Neoplasms	Associate	27746856, 35440104
Carcinogenesis	Associate	31770286, 37344480
Carcinoma Hepatocellular	Associate	38238834
Carcinoma Non Small Cell Lung	Associate	36551208
Carcinoma Ovarian Epithelial	Associate	32448194
Cardiomyopathy Dilated	Associate	27923790, 37086582
Cell Transformation Neoplastic	Associate	33723235
Cleft Palate	Associate	32241273
COVID 19	Inhibit	39549292
Dermatitis Atopic	Associate	21453958
Developmental Disabilities	Associate	30850373, 31475481, 32012656, 35914810
Disease	Associate	26604000, 27328748
Disease Resistance	Associate	24947026
Drug Resistant Epilepsy	Associate	26604000, 30711678
Endometrial Neoplasms	Associate	37344480
Epilepsy	Associate	30711678, 31475481
Esophageal Neoplasms	Associate	30501006
Esophageal Squamous Cell Carcinoma	Inhibit	30501006
Fibrosis	Associate	28294974
Friedreich Ataxia	Associate	34923139
Glioblastoma	Associate	37660127
Glioma	Associate	35697672
Glomerulonephritis Membranous	Stimulate	30566949
Heart Diseases	Associate	35914810
Heart Failure	Associate	37086582
Hereditary Sensory and Autonomic Neuropathies	Associate	31475481
Huntington Disease	Associate	21257639, 26122121
Hypospadias	Associate	32728162
Hypoxia	Stimulate	19525928
Hypoxia	Associate	28590414
Idiopathic Pulmonary Fibrosis	Associate	28294974
Infantile Epileptic Dyskinetic Encephalopathy	Associate	27328748
Intervertebral Disc Degeneration	Associate	37817199
Lung Neoplasms	Associate	23792636, 32767829
Lung Neoplasms	Stimulate	31770286
Lupus Erythematosus Systemic	Associate	34299244
Lymphatic Metastasis	Stimulate	23128392
Malformations of Cortical Development Group I	Associate	32787872
Mandibular Nerve Injuries	Associate	37580749
Melanoma	Associate	30185782, 40141318
Mitochondrial Diseases	Associate	18599615, 22773688, 23028930, 24080278, 24252614, 26122121, 27328748, 28040727, 30501006, 33586027, 35368865, 37141173, 37315759, 37344480
Muscle Hypotonia	Associate	30850373, 35914810
Myelodysplastic Syndromes	Associate	29725013
Myopathy with Giant Abnormal Mitochondria	Associate	22428580
Neoplasms	Associate	19525928, 27746856, 32448194, 33302576
Neoplasms	Stimulate	33450375
Neoplasms	Inhibit	35368865
Neoplasms Squamous Cell	Associate	37198593
Nephrotic Syndrome	Stimulate	30566949
Nerve Degeneration	Associate	21257639
Nervous System Diseases	Associate	27328748
Neuroblastoma	Associate	26518267, 26812016
Neurodegenerative Diseases	Associate	26122121, 32787872
Neurologic Manifestations	Associate	22428580, 30801875, 34573276
Nystagmus Pathologic	Associate	30850373
Optic Atrophy	Associate	30850373
Ovarian Neoplasms	Associate	32448194
Parkinson Disease	Associate	22428580, 26122121, 28040727
Peroxisomal Disorders	Associate	27328748
Pituitary Neoplasms	Associate	35368865
Platelet Signal Processing Defect	Associate	26122121
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	27831567
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	27831567
Prostatic Neoplasms	Associate	21724752
Protein Energy Malnutrition	Associate	35368865
Pulmonary Arterial Hypertension	Stimulate	33450375
Pulmonary Arterial Hypertension	Associate	37442283
Respiratory Insufficiency	Associate	28040727
Seizures	Associate	30850373, 35914810
Sleep Deprivation	Associate	20489733, 21292769, 24176854, 24610934, 26518267, 26813789, 27923790, 28040727, 28450286, 29725013, 30158296, 33146568, 34573276, 36613786, 37442283, 38084427 View all (1 more)
Sleep Deprivation	Stimulate	24080278, 26093086
Smooth Muscle Tumor	Associate	36675156
Spastic ataxia Charlevoix Saguenay type	Associate	27288452
Squamous Cell Carcinoma of Head and Neck	Associate	37198593
Status Asthmaticus	Stimulate	33146568
Urinary Bladder Neoplasms	Associate	35669725
Vascular Diseases	Associate	27923790
Vascular System Injuries	Inhibit	37315759

DNM1L (dynamin 1 like)