Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10050
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 17 member 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC17A4
Synonyms (NCBI Gene) Gene synonyms aliases	KAIA2138
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p22.2
Summary Summary of gene provided in NCBI Entrez Gene.	Phosphate homeostasis is maintained by regulating intake, intestinal absorption, bone deposition and resorption, and renal excretion of phosphate. The central molecule in the control of phosphate excretion from the kidney is the sodium/phosphate cotranspo

Show/Hide all(45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022042	hsa-miR-128-3p	Microarray	17612493
MIRT1353414	hsa-miR-320a	CLIP-seq
MIRT1353415	hsa-miR-320b	CLIP-seq
MIRT1353416	hsa-miR-320c	CLIP-seq
MIRT1353417	hsa-miR-320d	CLIP-seq
MIRT1353418	hsa-miR-320e	CLIP-seq
MIRT1353419	hsa-miR-3920	CLIP-seq
MIRT1353420	hsa-miR-4429	CLIP-seq
MIRT1353421	hsa-miR-4642	CLIP-seq
MIRT1353422	hsa-miR-4720-5p	CLIP-seq
MIRT1353423	hsa-miR-4799-3p	CLIP-seq
MIRT1353424	hsa-miR-760	CLIP-seq
MIRT2104588	hsa-miR-122	CLIP-seq
MIRT2104589	hsa-miR-3198	CLIP-seq
MIRT2104590	hsa-miR-3925-3p	CLIP-seq
MIRT2104591	hsa-miR-4279	CLIP-seq
MIRT2104592	hsa-miR-4309	CLIP-seq
MIRT2104593	hsa-miR-515-5p	CLIP-seq
MIRT2104594	hsa-miR-766	CLIP-seq
MIRT2329022	hsa-miR-1294	CLIP-seq
MIRT2329023	hsa-miR-1470	CLIP-seq
MIRT2329024	hsa-miR-1976	CLIP-seq
MIRT2329025	hsa-miR-2681	CLIP-seq
MIRT2329026	hsa-miR-3714	CLIP-seq
MIRT2329027	hsa-miR-4287	CLIP-seq
MIRT2329028	hsa-miR-4469	CLIP-seq
MIRT2329029	hsa-miR-4470	CLIP-seq
MIRT2329030	hsa-miR-4659a-5p	CLIP-seq
MIRT2329031	hsa-miR-4659b-5p	CLIP-seq
MIRT2329032	hsa-miR-4667-3p	CLIP-seq
MIRT2329033	hsa-miR-4685-3p	CLIP-seq
MIRT2329034	hsa-miR-4691-5p	CLIP-seq
MIRT2329035	hsa-miR-4713-5p	CLIP-seq
MIRT2329036	hsa-miR-4722-3p	CLIP-seq
MIRT2329037	hsa-miR-4738-3p	CLIP-seq
MIRT2329038	hsa-miR-4769-3p	CLIP-seq
MIRT2459503	hsa-miR-4727-5p	CLIP-seq
MIRT2329038	hsa-miR-4769-3p	CLIP-seq
MIRT2459504	hsa-miR-544	CLIP-seq
MIRT2459503	hsa-miR-4727-5p	CLIP-seq
MIRT2329038	hsa-miR-4769-3p	CLIP-seq
MIRT2459504	hsa-miR-544	CLIP-seq
MIRT2459503	hsa-miR-4727-5p	CLIP-seq
MIRT2329038	hsa-miR-4769-3p	CLIP-seq
MIRT2459504	hsa-miR-544	CLIP-seq

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005436	Function	Sodium:phosphate symporter activity	TAS	10319585
GO:0005764	Component	Lysosome	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0006796	Process	Phosphate-containing compound metabolic process	TAS	10319585
GO:0006814	Process	Sodium ion transport	TAS	10319585
GO:0006820	Process	Anion transport	IBA	21873635
GO:0015136	Function	Sialic acid transmembrane transporter activity	IBA	21873635
GO:0015739	Process	Sialic acid transport	IBA	21873635
GO:0016020	Component	Membrane	TAS	10319585
GO:0016021	Component	Integral component of membrane	IBA	21873635
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IBA	21873635
GO:0035725	Process	Sodium ion transmembrane transport	IEA

MIM	HGNC	e!Ensembl
604216	10932	ENSG00000146039

Protein

UniProt ID

Q9Y2C5

Protein name

Probable small intestine urate exporter (Solute carrier family 17 member 4)

Protein function

Acts as a membrane potential-dependent organic anion transporter, the transport requires a low concentration of chloride ions (PubMed:22460716). Mediates chloride-dependent transport of urate (PubMed:22460716). Mediates sodium-independent high a

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07690	MFS_1	43 → 444	Major Facilitator Superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Abundantly expressed in pancreas, liver, colon and small intestine, less in kidney. Not detected in the adrenal glands, brain, placenta, heart, testis, skeletal muscle, and lungs. {ECO:0000269|PubMed:10319585, ECO:0000269|PubMed:224607

Sequence

MSTGPDVKATVGDISSDGNLNVAQEECSRKGFCSVRHGLALILQLCNFSIYTQQMNLSIA
IPAMVNNTAPPSQPNASTERPSTDSQGYWNETLKEFKAMAPAYDWSPEIQGIILSSLNYG
SFLAPIPSGYVAGIFGAKYVVGAGLFISSFLTLFIPLAANAGVALLIVLRIVQGIAQVMV
LTGQYSIWVKWAPPLERSQLTTIAGSGSMLGSFIVLLAGGLLCQTIGWPYVFYIFGGIGC
ACCPLWFPLIYDDPVNHPFISAGEKRYIVCSLAQQDCSPGWSLPIRAMIKSLPLWAILVS
YFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGLLADFLLSRKI
LRLITIRKLFTAIGVLFPSVILVSLPWVRSSHSMTMTFLVLSSAISSFCESGALVNFLDI
APRYTGFLKGLLQVFAHIAGAISPTAAGFFISQDSEFGWRNVFLLSAAVNISGLVFYLIF
GRADVQDWAKEQTFTHL

Sequence length

497

Interactions

View interactions

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Lung carcinoma	Carcinoma of lung	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355 View all (44 more)	28604730
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	30285260

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Atherosclerosis	Atherosclerosis	21909108	ClinVar
Coronary heart disease	Coronary heart disease	21971053	ClinVar

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text Mining
Atherosclerosis	Associate	24951662
Gout	Associate	22541845, 28252667
Hyperuricemia	Associate	28252667
Neoplasms	Associate	36325340
Prostatic Neoplasms	Associate	36325340

SLC17A4 (solute carrier family 17 member 4)