SLC17A4 (solute carrier family 17 member 4)

Gene

• Entrez ID: 10050
• Gene name: Solute carrier family 17 member 4
• Gene symbol: SLC17A4
• Synonyms (NCBI Gene): KAIA2138
• Chromosome: 6
• Chromosome location: 6p22.2
• Summary: Phosphate homeostasis is maintained by regulating intake, intestinal absorption, bone deposition and resorption, and renal excretion of phosphate. The central molecule in the control of phosphate excretion from the kidney is the sodium/phosphate cotranspo

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022042	hsa-miR-128-3p	Microarray	17612493
MIRT1353414	hsa-miR-320a	CLIP-seq
MIRT1353415	hsa-miR-320b	CLIP-seq
MIRT1353416	hsa-miR-320c	CLIP-seq
MIRT1353417	hsa-miR-320d	CLIP-seq
MIRT1353418	hsa-miR-320e	CLIP-seq
MIRT1353419	hsa-miR-3920	CLIP-seq
MIRT1353420	hsa-miR-4429	CLIP-seq
MIRT1353421	hsa-miR-4642	CLIP-seq
MIRT1353422	hsa-miR-4720-5p	CLIP-seq
MIRT1353423	hsa-miR-4799-3p	CLIP-seq
MIRT1353424	hsa-miR-760	CLIP-seq
MIRT2104588	hsa-miR-122	CLIP-seq
MIRT2104589	hsa-miR-3198	CLIP-seq
MIRT2104590	hsa-miR-3925-3p	CLIP-seq
MIRT2104591	hsa-miR-4279	CLIP-seq
MIRT2104592	hsa-miR-4309	CLIP-seq
MIRT2104593	hsa-miR-515-5p	CLIP-seq
MIRT2104594	hsa-miR-766	CLIP-seq
MIRT2329022	hsa-miR-1294	CLIP-seq
MIRT2329023	hsa-miR-1470	CLIP-seq
MIRT2329024	hsa-miR-1976	CLIP-seq
MIRT2329025	hsa-miR-2681	CLIP-seq
MIRT2329026	hsa-miR-3714	CLIP-seq
MIRT2329027	hsa-miR-4287	CLIP-seq
MIRT2329028	hsa-miR-4469	CLIP-seq
MIRT2329029	hsa-miR-4470	CLIP-seq
MIRT2329030	hsa-miR-4659a-5p	CLIP-seq
MIRT2329031	hsa-miR-4659b-5p	CLIP-seq
MIRT2329032	hsa-miR-4667-3p	CLIP-seq
MIRT2329033	hsa-miR-4685-3p	CLIP-seq
MIRT2329034	hsa-miR-4691-5p	CLIP-seq
MIRT2329035	hsa-miR-4713-5p	CLIP-seq
MIRT2329036	hsa-miR-4722-3p	CLIP-seq
MIRT2329037	hsa-miR-4738-3p	CLIP-seq
MIRT2329038	hsa-miR-4769-3p	CLIP-seq
MIRT2459503	hsa-miR-4727-5p	CLIP-seq
MIRT2329038	hsa-miR-4769-3p	CLIP-seq
MIRT2459504	hsa-miR-544	CLIP-seq
MIRT2459503	hsa-miR-4727-5p	CLIP-seq
MIRT2329038	hsa-miR-4769-3p	CLIP-seq
MIRT2459504	hsa-miR-544	CLIP-seq
MIRT2459503	hsa-miR-4727-5p	CLIP-seq
MIRT2329038	hsa-miR-4769-3p	CLIP-seq
MIRT2459504	hsa-miR-544	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005436	Function	Sodium:phosphate symporter activity	IEA
GO:0005436	Function	Sodium:phosphate symporter activity	TAS	10319585
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10319585
GO:0006796	Process	Phosphate-containing compound metabolic process	TAS	10319585
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0006814	Process	Sodium ion transport	TAS	10319585
GO:0015143	Function	Urate transmembrane transporter activity	IDA	22460716
GO:0015143	Function	Urate transmembrane transporter activity	IEA
GO:0015293	Function	Symporter activity	IEA
GO:0015349	Function	Thyroid hormone transmembrane transporter activity	IDA	30367059
GO:0015349	Function	Thyroid hormone transmembrane transporter activity	IMP	34937426
GO:0015747	Process	Urate transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	10319585
GO:0016324	Component	Apical plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IBA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0031526	Component	Brush border membrane	IDA	22460716
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0044341	Process	Sodium-dependent phosphate transport	IBA
GO:0044341	Process	Sodium-dependent phosphate transport	IDA	22460716
GO:0055085	Process	Transmembrane transport	IEA
GO:0070327	Process	Thyroid hormone transport	IEA

Other IDs

• MIM: 604216
• HGNC: 10932
• e!Ensembl: ENSG00000146039

Protein

• UniProt ID: Q9Y2C5
• Protein name: Probable small intestine urate exporter (Solute carrier family 17 member 4)
• Protein function: Acts as a membrane potential-dependent organic anion transporter, the transport requires a low concentration of chloride ions (PubMed:22460716). Mediates chloride-dependent transport of urate (PubMed:22460716). Mediates sodium-independent high a
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07690	MFS_1	43 → 444	Major Facilitator Superfamily	Family

• Tissue specificity: TISSUE SPECIFICITY: Abundantly expressed in pancreas, liver, colon and small intestine, less in kidney. Not detected in the adrenal glands, brain, placenta, heart, testis, skeletal muscle, and lungs. {ECO:0000269|PubMed:10319585, ECO:0000269|PubMed:224607
• Sequence:

  MSTGPDVKATVGDISSDGNLNVAQEECSRKGFCSVRHGLALILQLCNFSIYTQQMNLSIA
  IPAMVNNTAPPSQPNASTERPSTDSQGYWNETLKEFKAMAPAYDWSPEIQGIILSSLNYG
  SFLAPIPSGYVAGIFGAKYVVGAGLFISSFLTLFIPLAANAGVALLIVLRIVQGIAQVMV
  LTGQYSIWVKWAPPLERSQLTTIAGSGSMLGSFIVLLAGGLLCQTIGWPYVFYIFGGIGC
  ACCPLWFPLIYDDPVNHPFISAGEKRYIVCSLAQQDCSPGWSLPIRAMIKSLPLWAILVS
  YFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGLLADFLLSRKI
  LRLITIRKLFTAIGVLFPSVILVSLPWVRSSHSMTMTFLVLSSAISSFCESGALVNFLDI
  APRYTGFLKGLLQVFAHIAGAISPTAAGFFISQDSEFGWRNVFLLSAAVNISGLVFYLIF
  GRADVQDWAKEQTFTHL

• Sequence length: 497

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Clear cell carcinoma of kidney	Uncertain significance	rs376955338	RCV005929132

Associations from Text Mining
Disease Name	Relationship Type	References
Atherosclerosis	Associate	24951662
Gout	Associate	22541845, 28252667
Hyperuricemia	Associate	28252667
Neoplasms	Associate	36325340
Prostatic Neoplasms	Associate	36325340