SH2D3A (SH2 domain containing 3A)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10045
Gene name Gene Name - the full gene name approved by the HGNC.
SH2 domain containing 3A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SH2D3A
Synonyms (NCBI Gene) Gene synonyms aliases
NSP1
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(9)
miRTarBase ID miRNA Experiments Reference
MIRT016816 hsa-miR-335-5p Microarray 18185580
MIRT022136 hsa-miR-124-3p Microarray 18668037
MIRT1344237 hsa-miR-143 CLIP-seq
MIRT1344238 hsa-miR-3674 CLIP-seq
MIRT1344239 hsa-miR-4328 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0001784 Function Phosphotyrosine residue binding IEA
GO:0005085 Function Guanyl-nucleotide exchange factor activity IEA
GO:0005515 Function Protein binding IPI 24658140, 31980649
GO:0007254 Process JNK cascade TAS 10187783
GO:0007264 Process Small GTPase mediated signal transduction IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
604721 16885 ENSG00000125731
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9BRG2
Protein name SH2 domain-containing protein 3A (Novel SH2-containing protein 1)
Protein function May play a role in JNK activation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00017 SH2 15 → 95 SH2 domain Domain
Tissue specificity TISSUE SPECIFICITY: Weakly expressed in placenta, fetal kidney, fetal lung, adult pancreas, adult kidney and adult lung. {ECO:0000269|PubMed:10187783}.
Sequence 
MQVPQDGEDLAGQPWYHGLLSRQKAEALLQQNGDFLVRASGSRGGNPVISCRWRGSALHF
EVFRVALRPRPGRPTALFQLEDEQFPSIPALVHSYMTGRRPLSQATGAVVSRPVTWQGPL
RRSFSEDTLMDGPARIEPLRARKWSNSQPADLAHMGRSREDPAGMEASTMPISALPRTSS
DPVLLKAPAPLGTVADSLRASDGQLQAKAPTKPPRTPSFELPDASERPPTYCELVPRVPS
VQGTSPSQSCPEPEAPWWEAEEDEEEENRCFTRPQAEISFCPHDAPSCLLGPQNRPLEPQ
VLHTLRGLFLEHHPGSTALHLLLVDCQATGLLGVTRDQRGNMGVSSGLELLTLPHGHHLR
LELLERHQTLALAGALAVLGCSGPLEERAAALRGLVELALALRPGAAGDLPGLAAVMGAL
LMPQVSRLEHTWRQLRRSHTEAALAFEQELKPLMRALDEGAGPCDPGEVALPHVAPMVRL
LEGEEVAGPLDESCERLLRTLHGARHMVRDAPKFRKVAAQRLRGFRPNPELREALTTGFV
RRLLWGSRGAGAPRAERFEKFQRVLGVLSQRLEPDR
Sequence length 576
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Show/Hide Text Mining Associations (10)
Associations from Text Mining
Disease Name Relationship Type References
Coronavirus Infections Associate 26311885
COVID 19 Associate 20609418, 23658627, 32181901, 32867854, 33933885, 34719824, 34749522, 35323109, 35434785, 35715434, 38427561
Drug Related Side Effects and Adverse Reactions Associate 36847528
Gastroenteritis Associate 25626907
Hypoxia Stimulate 34929442
Infections Associate 34749522, 37205707
Lung Diseases Associate 34929442
Lung Neoplasms Stimulate 34929442
Nasopharyngeal Carcinoma Associate 24933637
Uveal melanoma Associate 31903983