TROAP (trophinin associated protein)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 10024
Gene name Trophinin associated protein
Gene symbol TROAP
Synonyms (NCBI Gene)
TASTIN
Chromosome 12
Chromosome location 12q13.12
miRNA miRNA information provided by mirtarbase database.
28
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (28)
miRTarBase ID miRNA Experiments Reference
MIRT024690 hsa-miR-215-5p Microarray 19074876
MIRT026899 hsa-miR-192-5p Microarray 19074876
MIRT042226 hsa-miR-484 CLASH 23622248
MIRT039703 hsa-miR-615-3p CLASH 23622248
MIRT734530 hsa-miR-519d-3p Luciferase reporter assayImmunoprecipitaion (IP)qRT-PCR 32796815
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (5)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 9560222, 17360433, 19060904, 21516116, 23602568, 25416956, 26949739, 28514442, 30561431, 32296183, 32707033, 33961781
GO:0005737 Component Cytoplasm IEA
GO:0005737 Component Cytoplasm TAS 7758945
GO:0007155 Process Cell adhesion IEA
GO:0007155 Process Cell adhesion TAS 7758945
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
603872 12327 ENSG00000135451
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q12815
Protein name Tastin (Trophinin-assisting protein) (Trophinin-associated protein)
Protein function Could be involved with bystin and trophinin in a cell adhesion molecule complex that mediates an initial attachment of the blastocyst to uterine epithelial cells at the time of the embryo implantation.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Strong expression at implantation sites. Was exclusively localized to the apical side of the syncytiotrophoblast. Also found in macrophages.
Sequence 
MTTRQATKDPLLRGVSPTPSKIPVRSQKRTPFPTVTSCAVDQENQDPRRWVQKPPLNIQR
PLVDSAGPRPKARHQAETSQRLVGISQPRNPLEELRPSPRGQNVGPGPPAQTEAPGTIEF
VADPAALATILSGEGVKSCHLGRQPSLAKRVLVRGSQGGTTQRVQGVRASAYLAPRTPTH
RLDPARASCFSRLEGPGPRGRTLCPQRLQALISPSGPSFHPSTRPSFQELRRETAGSSRT
SVSQASGLLLETPVQPAFSLPKGEREVVTHSDEGGVASLGLAQRVPLRENREMSHTRDSH
DSHLMPSPAPVAQPLPGHVVPCPSPFGRAQRVPSPGPPTLTSYSVLRRLTVQPKTRFTPM
PSTPRVQQAQWLRGVSPQSCSEDPALPWEQVAVRLFDQESCIRSLEGSGKPPVATPSGPH
SNRTPSLQEVKIQRIGILQQLLRQEVEGLVGGQCVPLNGGSSLDMVELQPLLTEISRTLN
ATEHNSGTSHLPGLLKHSGLPKPCLPEECGEPQPCPPAEPGPPEAFCRSEPEIPEPSLQE
QLEVPEPYPPAEPRPLESCCRSEPEIPESSRQEQLEVPEPCPPAEPRPLESYCRIEPEIP
ESSRQEQLEVPEPCPPAEPGPLQPSTQGQSGPPGPCPRVELGASEPCTLEHRSLESSLPP
CCSQWAPATTSLIFSSQHPLCASPPICSLQSLRPPAGQAGLSNLAPRTLALRERLKSCLT
AIHCFHEARLDDECAFYTSRAPPSGPTRVCTNPVATLLEWQDALCFIPVGSAAPQGSP
Sequence length 778
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Familial cancer of breast Likely benign rs569298102 RCV005933083
Show/Hide Text Mining Associations (17)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 34139453
Breast Neoplasms Stimulate 31198787
Carcinoma Hepatocellular Associate 22997493
Carcinoma Hepatocellular Inhibit 29117881
Carcinoma Ovarian Epithelial Associate 24071868
Carcinoma Renal Cell Associate 34287099
Colorectal Neoplasms Associate 30021381, 32796815
Job Syndrome Associate 32541515
Leukemia Associate 36938721
Leukemia Myeloid Acute Associate 36938721