Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10016
Gene name Gene Name - the full gene name approved by the HGNC.
Programmed cell death 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PDCD6
Synonyms (NCBI Gene) Gene synonyms aliases
ALG-2, ALG2, PEF1B
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5p15.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a calcium-binding protein belonging to the penta-EF-hand protein family. Calcium binding is important for homodimerization and for conformational changes required for binding to other protein partners. This gene product participates in T
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005725 hsa-miR-183-5p qRT-PCR 20602797
MIRT040945 hsa-miR-18a-3p CLASH 23622248
MIRT440016 hsa-miR-218-5p HITS-CLIP 23212916
MIRT440016 hsa-miR-218-5p HITS-CLIP 23212916
MIRT1219454 hsa-miR-1207-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0000287 Function Magnesium ion binding ISS
GO:0001525 Process Angiogenesis IEA
GO:0001938 Process Positive regulation of endothelial cell proliferation IDA 21893193
GO:0005509 Function Calcium ion binding IDA 25667979
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601057 8765 ENSG00000249915
Protein
UniProt ID O75340
Protein name Programmed cell death protein 6 (Apoptosis-linked gene 2 protein homolog) (ALG-2)
Protein function Calcium sensor that plays a key role in processes such as endoplasmic reticulum (ER)-Golgi vesicular transport, endosomal biogenesis or membrane repair. Acts as an adapter that bridges unrelated proteins or stabilizes weak protein-protein comple
PDB 2ZN8 , 2ZN9 , 2ZND , 2ZNE , 2ZRS , 2ZRT , 3AAJ , 3AAK , 3WXA , 5GQQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13202 EF-hand_5 30 53 EF hand Domain
PF13499 EF-hand_7 92 156 EF-hand domain pair Domain
Sequence
MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPF
NPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALS
GFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCI
VLQRLTDIFRRYDTDQDGWIQVSY
EQYLSMVFSIV
Sequence length 191
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Unknown
Disease term Disease name Evidence References Source
Mental depression Endogenous depression 19955554 ClinVar
Breast Cancer Breast Cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Alzheimer disease Alzheimer disease GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 18632575
Breast Neoplasms Associate 35732318
Carcinogenesis Associate 22161137, 22412903, 37005078
Carcinoma Hepatocellular Associate 37005078
Carcinoma Non Small Cell Lung Associate 23167403
Carcinoma Ovarian Epithelial Associate 22369209
Colorectal Neoplasms Associate 26678268
COVID 19 Associate 37222960
Death Associate 24792888
Depressive Disorder Stimulate 19955554