Gene Gene information from NCBI Gene database.
Entrez ID 10016
Gene name Programmed cell death 6
Gene symbol PDCD6
Synonyms (NCBI Gene)
ALG-2ALG2PEF1B
Chromosome 5
Chromosome location 5p15.33
Summary This gene encodes a calcium-binding protein belonging to the penta-EF-hand protein family. Calcium binding is important for homodimerization and for conformational changes required for binding to other protein partners. This gene product participates in T
miRNA miRNA information provided by mirtarbase database.
157
miRTarBase ID miRNA Experiments Reference
MIRT005725 hsa-miR-183-5p qRT-PCR 20602797
MIRT040945 hsa-miR-18a-3p CLASH 23622248
MIRT440016 hsa-miR-218-5p HITS-CLIP 23212916
MIRT440016 hsa-miR-218-5p HITS-CLIP 23212916
MIRT1219454 hsa-miR-1207-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
61
GO ID Ontology Definition Evidence Reference
GO:0000287 Function Magnesium ion binding IEA
GO:0000287 Function Magnesium ion binding ISS
GO:0001525 Process Angiogenesis IEA
GO:0001938 Process Positive regulation of endothelial cell proliferation IDA 21893193
GO:0005509 Function Calcium ion binding IDA 25667979
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601057 8765 ENSG00000249915
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75340
Protein name Programmed cell death protein 6 (Apoptosis-linked gene 2 protein homolog) (ALG-2)
Protein function Calcium sensor that plays a key role in processes such as endoplasmic reticulum (ER)-Golgi vesicular transport, endosomal biogenesis or membrane repair. Acts as an adapter that bridges unrelated proteins or stabilizes weak protein-protein comple
PDB 2ZN8 , 2ZN9 , 2ZND , 2ZNE , 2ZRS , 2ZRT , 3AAJ , 3AAK , 3WXA , 5GQQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13202 EF-hand_5 30 53 EF hand Domain
PF13499 EF-hand_7 92 156 EF-hand domain pair Domain
Sequence
MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPF
NPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALS
GFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCI
VLQRLTDIFRRYDTDQDGWIQVSY
EQYLSMVFSIV
Sequence length 191
Interactions View interactions