Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10011
Gene name	Steroid receptor RNA activator 1
Gene symbol	SRA1
Synonyms (NCBI Gene)	SRASRAPSTRAA1pp7684
Chromosome	5
Chromosome location	5q31.3
Summary	Both long non-coding and protein-coding RNAs are transcribed from this gene, and they represent alternatively spliced transcript variants. This gene was initially defined as a non-coding RNA, which is a coactivator for several nuclear receptors (NRs) and

124

Show/Hide all (124)

miRTarBase ID	miRNA	Experiments	Reference
MIRT439547	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439547	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1387592	hsa-miR-1271	CLIP-seq
MIRT1387593	hsa-miR-182	CLIP-seq
MIRT1387594	hsa-miR-1827	CLIP-seq
MIRT1387595	hsa-miR-216a	CLIP-seq
MIRT1387596	hsa-miR-31	CLIP-seq
MIRT1387597	hsa-miR-3663-5p	CLIP-seq
MIRT1387598	hsa-miR-4264	CLIP-seq
MIRT1387599	hsa-miR-4797-3p	CLIP-seq
MIRT1387600	hsa-miR-759	CLIP-seq
MIRT1387601	hsa-miR-96	CLIP-seq
MIRT2116118	hsa-miR-1197	CLIP-seq
MIRT2116119	hsa-miR-3131	CLIP-seq
MIRT2116120	hsa-miR-4453	CLIP-seq
MIRT2116121	hsa-miR-4538	CLIP-seq
MIRT2116122	hsa-miR-4652-5p	CLIP-seq
MIRT2116123	hsa-miR-4661-5p	CLIP-seq
MIRT2116124	hsa-miR-611	CLIP-seq
MIRT2116118	hsa-miR-1197	CLIP-seq
MIRT1387592	hsa-miR-1271	CLIP-seq
MIRT2338541	hsa-miR-151-5p	CLIP-seq
MIRT2338542	hsa-miR-151b	CLIP-seq
MIRT2116119	hsa-miR-3131	CLIP-seq
MIRT2338543	hsa-miR-3202	CLIP-seq
MIRT2338544	hsa-miR-3678-3p	CLIP-seq
MIRT2338545	hsa-miR-4270	CLIP-seq
MIRT2338546	hsa-miR-4436b-3p	CLIP-seq
MIRT2338547	hsa-miR-4441	CLIP-seq
MIRT2116120	hsa-miR-4453	CLIP-seq
MIRT2116121	hsa-miR-4538	CLIP-seq
MIRT2116122	hsa-miR-4652-5p	CLIP-seq
MIRT2116123	hsa-miR-4661-5p	CLIP-seq
MIRT2338548	hsa-miR-4668-5p	CLIP-seq
MIRT2338549	hsa-miR-4672	CLIP-seq
MIRT2116124	hsa-miR-611	CLIP-seq
MIRT1387601	hsa-miR-96	CLIP-seq
MIRT2395145	hsa-miR-3154	CLIP-seq
MIRT2632064	hsa-miR-1273f	CLIP-seq
MIRT2632065	hsa-miR-1273g	CLIP-seq
MIRT2632066	hsa-miR-1302	CLIP-seq
MIRT2632067	hsa-miR-130a	CLIP-seq
MIRT2632068	hsa-miR-130b	CLIP-seq
MIRT2632069	hsa-miR-148a	CLIP-seq
MIRT2632070	hsa-miR-148b	CLIP-seq
MIRT2632071	hsa-miR-152	CLIP-seq
MIRT2632072	hsa-miR-194	CLIP-seq
MIRT2632073	hsa-miR-1972	CLIP-seq
MIRT2632074	hsa-miR-19a	CLIP-seq
MIRT2632075	hsa-miR-19b	CLIP-seq
MIRT1387595	hsa-miR-216a	CLIP-seq
MIRT2632076	hsa-miR-216b	CLIP-seq
MIRT2632077	hsa-miR-301a	CLIP-seq
MIRT2632078	hsa-miR-301b	CLIP-seq
MIRT2632079	hsa-miR-3117-3p	CLIP-seq
MIRT2632080	hsa-miR-3124-3p	CLIP-seq
MIRT2632081	hsa-miR-3126-5p	CLIP-seq
MIRT2632082	hsa-miR-3136-3p	CLIP-seq
MIRT2395145	hsa-miR-3154	CLIP-seq
MIRT2632083	hsa-miR-3169	CLIP-seq
MIRT2632084	hsa-miR-3176	CLIP-seq
MIRT2632085	hsa-miR-3199	CLIP-seq
MIRT2632086	hsa-miR-323-5p	CLIP-seq
MIRT2632087	hsa-miR-3607-3p	CLIP-seq
MIRT2632088	hsa-miR-3653	CLIP-seq
MIRT2632089	hsa-miR-3666	CLIP-seq
MIRT2632090	hsa-miR-3686	CLIP-seq
MIRT2632091	hsa-miR-3910	CLIP-seq
MIRT2632092	hsa-miR-3922-3p	CLIP-seq
MIRT2632093	hsa-miR-3941	CLIP-seq
MIRT2632094	hsa-miR-4286	CLIP-seq
MIRT2632095	hsa-miR-4295	CLIP-seq
MIRT2632096	hsa-miR-4298	CLIP-seq
MIRT2632097	hsa-miR-4419a	CLIP-seq
MIRT2632098	hsa-miR-4469	CLIP-seq
MIRT2632099	hsa-miR-4480	CLIP-seq
MIRT2632100	hsa-miR-4510	CLIP-seq
MIRT2632101	hsa-miR-454	CLIP-seq
MIRT2632102	hsa-miR-4643	CLIP-seq
MIRT2632103	hsa-miR-4648	CLIP-seq
MIRT2632104	hsa-miR-4650-5p	CLIP-seq
MIRT2632105	hsa-miR-466	CLIP-seq
MIRT2632106	hsa-miR-4669	CLIP-seq
MIRT2338549	hsa-miR-4672	CLIP-seq
MIRT2632107	hsa-miR-4680-5p	CLIP-seq
MIRT2632108	hsa-miR-4726-3p	CLIP-seq
MIRT2632109	hsa-miR-4759	CLIP-seq
MIRT2632110	hsa-miR-4778-3p	CLIP-seq
MIRT2632111	hsa-miR-493	CLIP-seq
MIRT2632112	hsa-miR-511	CLIP-seq
MIRT2632113	hsa-miR-515-5p	CLIP-seq
MIRT2632114	hsa-miR-542-3p	CLIP-seq
MIRT2632115	hsa-miR-576-5p	CLIP-seq
MIRT2632116	hsa-miR-627	CLIP-seq
MIRT2632117	hsa-miR-642a	CLIP-seq
MIRT2632118	hsa-miR-653	CLIP-seq
MIRT2632119	hsa-miR-876-3p	CLIP-seq
MIRT2632120	hsa-miR-924	CLIP-seq
MIRT2632064	hsa-miR-1273f	CLIP-seq
MIRT2632066	hsa-miR-1302	CLIP-seq
MIRT2632073	hsa-miR-1972	CLIP-seq
MIRT2632082	hsa-miR-3136-3p	CLIP-seq
MIRT2395145	hsa-miR-3154	CLIP-seq
MIRT2632084	hsa-miR-3176	CLIP-seq
MIRT2632085	hsa-miR-3199	CLIP-seq
MIRT2632086	hsa-miR-323-5p	CLIP-seq
MIRT2632088	hsa-miR-3653	CLIP-seq
MIRT2632091	hsa-miR-3910	CLIP-seq
MIRT2632092	hsa-miR-3922-3p	CLIP-seq
MIRT2632096	hsa-miR-4298	CLIP-seq
MIRT2632098	hsa-miR-4469	CLIP-seq
MIRT2632099	hsa-miR-4480	CLIP-seq
MIRT2632102	hsa-miR-4643	CLIP-seq
MIRT2632103	hsa-miR-4648	CLIP-seq
MIRT2632104	hsa-miR-4650-5p	CLIP-seq
MIRT2632106	hsa-miR-4669	CLIP-seq
MIRT2632107	hsa-miR-4680-5p	CLIP-seq
MIRT2632108	hsa-miR-4726-3p	CLIP-seq
MIRT2632110	hsa-miR-4778-3p	CLIP-seq
MIRT2632111	hsa-miR-493	CLIP-seq
MIRT2632113	hsa-miR-515-5p	CLIP-seq
MIRT2632114	hsa-miR-542-3p	CLIP-seq
MIRT2632117	hsa-miR-642a	CLIP-seq
MIRT2632119	hsa-miR-876-3p	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002153	Function	Steroid receptor RNA activator RNA binding	IDA	24486609, 24486611
GO:0002153	Function	Steroid receptor RNA activator RNA binding	IDA	20855289
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0005515	Function	Protein binding	IPI	20398657
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12565891, 24486609, 27086651
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	24486609, 27086651
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005929	Component	Cilium	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IMP	24486609
GO:0006915	Process	Apoptotic process	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0045171	Component	Intercellular bridge	IDA
GO:0045662	Process	Negative regulation of myoblast differentiation	IMP	20855289
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:1990904	Component	Ribonucleoprotein complex	IDA	24486609

MIM	HGNC	e!Ensembl
603819	11281	ENSG00000213523

Q9HD15

Protein name

Steroid receptor RNA activator 1 (Steroid receptor RNA activator protein) (SRAP)

Protein function

Functional RNA which acts as a transcriptional coactivator that selectively enhances steroid receptor-mediated transactivation ligand-independently through a mechanism involving the modulating N-terminal domain (AF-1) of steroid receptors. Also

PDB

2MGX , 4NBO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07304	SRA1	75 → 219	Steroid receptor RNA activator (SRA1)	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in liver and skeletal muscle and to a lesser extent in brain. Also expressed in both normal and tumorigenic breast epithelial cell lines. Significantly up-regulated in human tumors of the breast, ovary, and uterus. {EC

Sequence

MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGS
PRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQ
ALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIH
RSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKSAATAEKNHTIPGFQQAS

Sequence length

236

Interactions

View interactions

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Amenorrhea	Uncertain significance	rs1491190229	RCV001849747
Colon adenocarcinoma	Uncertain significance	rs771291291	RCV005930312
Hypogonadism with anosmia	Uncertain significance	rs1306465994	RCV000859989
SRA1-related disorder	Benign; Likely benign	rs148108594, rs35610885, rs141327120, rs149499620, rs148259347, rs115569414, rs201105057, rs35999684, rs200718775, rs76646635, rs34009206	RCV003956345 RCV003913393 RCV003970975 RCV003968895 RCV003958525 RCV003914703 RCV003942041 RCV003931950 RCV003976809 RCV003960782 RCV003936029

Show/Hide Text Mining Associations (36)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Atherosclerosis	Associate	18827892
Breast Neoplasms	Associate	19483093, 19740422, 23579816, 23699411, 23907597, 24884718, 26967566
Carcinogenesis	Associate	28085012, 29039612
Carcinoma Hepatocellular	Inhibit	28085012
Carcinoma Renal Cell	Associate	30816490
Carcinoma Renal Cell	Inhibit	33000206
Carcinoma Squamous Cell	Inhibit	31371629
Combined Pituitary Hormone Deficiency	Associate	35805171
Diabetes Mellitus Type 1	Associate	33572095
Diabetes Mellitus Type 2	Associate	34685582, 36552771, 36557031
Endometrial Neoplasms	Stimulate	31892849
Endometriosis	Inhibit	23749764
Glucosephosphate Dehydrogenase Deficiency	Associate	31892849
Hereditary Breast and Ovarian Cancer Syndrome	Associate	19483093
Hypogonadism	Associate	32982993, 35805171
Idiopathic Hypogonadotropic Hypogonadism	Associate	27086651
Inflammation	Associate	34685582, 36552771
Insulin Resistance	Associate	34685582
Light Fixation Seizure Syndrome	Associate	33649397
Melanoma	Associate	27210747
Mesothelioma Malignant	Associate	22011668
Metabolic Diseases	Associate	36552771
Metabolic Syndrome	Associate	35119092
Neoplasm Metastasis	Associate	31892849
Neoplasms	Associate	19483093, 23579816, 26581859, 26967566, 28085012, 28468300, 29039612, 31371629, 31892849, 33000206
Neoplasms Adipose Tissue	Associate	25609053
Obesity	Associate	25609053, 34685582, 36552771
Osteosarcoma	Inhibit	31106680
Ovarian Diseases	Associate	23749764
Ovarian Neoplasms	Associate	11461075
Parkinson Disease	Associate	32066731
Polycystic Ovary Syndrome	Associate	25609053, 32783135
Puberty Delayed	Associate	27086651
Thrombocytopenia Neonatal Alloimmune	Associate	2257303
Uterine Cervical Neoplasms	Associate	29039612
Uterine Cervicitis	Associate	29039612

SRA1 (steroid receptor RNA activator 1)