Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10000
Gene name	AKT serine/threonine kinase 3
Gene symbol	AKT3
Synonyms (NCBI Gene)	MPPHMPPH2PKB-GAMMAPKBGPRKBGRAC-PK-gammaRAC-gammaSTK-2
Chromosome	1
Chromosome location	1q43-q44
Summary	The protein encoded by this gene is a member of the AKT, also called PKB, serine/threonine protein kinase family. AKT kinases are known to be regulators of cell signaling in response to insulin and growth factors. They are involved in a wide variety of b

Show/Hide all (7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs397514605	T>C	Pathogenic	Coding sequence variant, missense variant, genic upstream transcript variant
rs397514606	C>T	Pathogenic	Coding sequence variant, 5 prime UTR variant, missense variant, genic upstream transcript variant
rs587776935	G>A	Likely-pathogenic, pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant, intron variant
rs886041100	A>T	Likely-pathogenic	Missense variant, coding sequence variant, genic upstream transcript variant
rs1064795602	C>T	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1085307712	T>G	Likely-pathogenic	Missense variant, coding sequence variant, genic upstream transcript variant
rs1574509510	T>C	Likely-pathogenic	Coding sequence variant, genic downstream transcript variant, missense variant

717

Show/Hide all (717)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003099	hsa-miR-122-5p	Luciferase reporter assayqRT-PCR	19296470
MIRT003334	hsa-miR-15a-5p	Review	20026422
MIRT003329	hsa-miR-16-5p	Review	20026422
MIRT006197	hsa-miR-519d-3p	Luciferase reporter assayWestern blot	22262409
MIRT006197	hsa-miR-519d-3p	Luciferase reporter assayWestern blot	22262409
MIRT006197	hsa-miR-519d-3p	Luciferase reporter assayWestern blot	22262409
MIRT003334	hsa-miR-15a-5p	Luciferase reporter assay	23233752
MIRT003329	hsa-miR-16-5p	Luciferase reporter assay	23233752
MIRT003329	hsa-miR-16-5p	Luciferase reporter assay	23233752
MIRT020391	hsa-miR-29c-3p	Sequencing	20371350
MIRT022432	hsa-miR-124-3p	Microarray	18668037
MIRT041618	hsa-miR-146b-5p	CLASH	23622248
MIRT572774	hsa-miR-5196-3p	PAR-CLIP	20371350
MIRT572773	hsa-miR-4793-5p	PAR-CLIP	20371350
MIRT572772	hsa-miR-6072	PAR-CLIP	20371350
MIRT572771	hsa-miR-6891-3p	PAR-CLIP	20371350
MIRT022432	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT568544	hsa-miR-548an	PAR-CLIP	20371350
MIRT568543	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT568542	hsa-miR-5582-5p	PAR-CLIP	20371350
MIRT568541	hsa-miR-552-5p	PAR-CLIP	20371350
MIRT562676	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT562675	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT562674	hsa-miR-221-3p	PAR-CLIP	20371350
MIRT562673	hsa-miR-222-3p	PAR-CLIP	20371350
MIRT562672	hsa-miR-569	PAR-CLIP	20371350
MIRT562671	hsa-miR-361-5p	PAR-CLIP	20371350
MIRT562670	hsa-miR-374a-3p	PAR-CLIP	20371350
MIRT003329	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT482118	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT003334	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT482117	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT482116	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT482115	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT482114	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT482113	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT482112	hsa-miR-595	PAR-CLIP	21572407
MIRT482111	hsa-miR-6758-5p	PAR-CLIP	21572407
MIRT482109	hsa-miR-6856-5p	PAR-CLIP	21572407
MIRT482110	hsa-miR-646	PAR-CLIP	21572407
MIRT482108	hsa-miR-3976	PAR-CLIP	21572407
MIRT482107	hsa-miR-4781-3p	PAR-CLIP	21572407
MIRT482106	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT482105	hsa-miR-520h	PAR-CLIP	21572407
MIRT482104	hsa-miR-545-3p	PAR-CLIP	21572407
MIRT482103	hsa-miR-4725-5p	PAR-CLIP	21572407
MIRT482102	hsa-miR-7854-3p	PAR-CLIP	21572407
MIRT482101	hsa-miR-6134	PAR-CLIP	21572407
MIRT482100	hsa-miR-567	PAR-CLIP	21572407
MIRT482099	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT482098	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT482097	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT482095	hsa-miR-2054	PAR-CLIP	21572407
MIRT482096	hsa-miR-297	PAR-CLIP	21572407
MIRT003329	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT482118	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT003334	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT482117	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT482116	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT482115	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT482114	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT482113	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT482112	hsa-miR-595	PAR-CLIP	23592263
MIRT482111	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT482109	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT482110	hsa-miR-646	PAR-CLIP	23592263
MIRT482108	hsa-miR-3976	PAR-CLIP	23592263
MIRT482107	hsa-miR-4781-3p	PAR-CLIP	23592263
MIRT482106	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT482105	hsa-miR-520h	PAR-CLIP	23592263
MIRT482104	hsa-miR-545-3p	PAR-CLIP	23592263
MIRT482103	hsa-miR-4725-5p	PAR-CLIP	23592263
MIRT482102	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT482101	hsa-miR-6134	PAR-CLIP	23592263
MIRT482100	hsa-miR-567	PAR-CLIP	23592263
MIRT482099	hsa-miR-223-5p	PAR-CLIP	23592263
MIRT482098	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT482097	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT482095	hsa-miR-2054	PAR-CLIP	23592263
MIRT482096	hsa-miR-297	PAR-CLIP	23592263
MIRT731395	hsa-miR-29b-1-5p	Luciferase reporter assayWestern blot	28365400
MIRT731395	hsa-miR-29b-1-5p	Luciferase reporter assayWestern blot	28365400
MIRT020391	hsa-miR-29c-3p	Luciferase reporter assayNext Generation Sequencing (NGS)qRT-PCR	28160548
MIRT731495	hsa-miR-29a-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26512921
MIRT731495	hsa-miR-29a-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26512921
MIRT731395	hsa-miR-29b-1-5p	Luciferase reporter assayWestern blot	28365400
MIRT731395	hsa-miR-29b-1-5p	Luciferase reporter assayWestern blot	28365400
MIRT482118	hsa-miR-15b-5p	Luciferase reporter assayqRT-PCRWestern blot	28254819
MIRT482118	hsa-miR-15b-5p	Luciferase reporter assayqRT-PCRWestern blot	28254819
MIRT053125	hsa-miR-29a-3p	Luciferase reporter assayqRT-PCRWestern blot	26482618
MIRT053125	hsa-miR-29a-3p	Luciferase reporter assayqRT-PCRWestern blot	26482618
MIRT735641	hsa-miR-29b-3p	Luciferase reporter assay	25784815
MIRT022432	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blotting	34277703
MIRT735546	hsa-miR-320a	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCR	33833996
MIRT735641	hsa-miR-29b-3p	Luciferase reporter assayWestern blottingqRT-PCR	32045877
MIRT735918	hsa-miR-641	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)Immunohistochemistry (IHC)qRT-PCR	32423991
MIRT482117	hsa-miR-424-5p	Luciferase reporter assayWestern blottingqRT-PCR	32520206
MIRT572774	hsa-miR-5196-3p	PAR-CLIP	20371350
MIRT572773	hsa-miR-4793-5p	PAR-CLIP	20371350
MIRT572772	hsa-miR-6072	PAR-CLIP	20371350
MIRT572771	hsa-miR-6891-3p	PAR-CLIP	20371350
MIRT022432	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT568544	hsa-miR-548an	PAR-CLIP	20371350
MIRT568543	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT568542	hsa-miR-5582-5p	PAR-CLIP	20371350
MIRT568541	hsa-miR-552-5p	PAR-CLIP	20371350
MIRT562676	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT562675	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT562674	hsa-miR-221-3p	PAR-CLIP	20371350
MIRT562673	hsa-miR-222-3p	PAR-CLIP	20371350
MIRT562672	hsa-miR-569	PAR-CLIP	20371350
MIRT562671	hsa-miR-361-5p	PAR-CLIP	20371350
MIRT562670	hsa-miR-374a-3p	PAR-CLIP	20371350
MIRT003329	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT482118	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT003334	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT482117	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT482116	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT482115	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT482114	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT482113	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT482112	hsa-miR-595	PAR-CLIP	21572407
MIRT482111	hsa-miR-6758-5p	PAR-CLIP	21572407
MIRT482109	hsa-miR-6856-5p	PAR-CLIP	21572407
MIRT482110	hsa-miR-646	PAR-CLIP	21572407
MIRT482108	hsa-miR-3976	PAR-CLIP	21572407
MIRT482107	hsa-miR-4781-3p	PAR-CLIP	21572407
MIRT482106	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT482105	hsa-miR-520h	PAR-CLIP	21572407
MIRT482104	hsa-miR-545-3p	PAR-CLIP	21572407
MIRT482103	hsa-miR-4725-5p	PAR-CLIP	21572407
MIRT482102	hsa-miR-7854-3p	PAR-CLIP	21572407
MIRT482101	hsa-miR-6134	PAR-CLIP	21572407
MIRT482100	hsa-miR-567	PAR-CLIP	21572407
MIRT482099	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT482098	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT482097	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT482095	hsa-miR-2054	PAR-CLIP	21572407
MIRT482096	hsa-miR-297	PAR-CLIP	21572407
MIRT003329	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT482118	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT003334	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT482117	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT482116	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT482115	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT482114	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT482113	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT482112	hsa-miR-595	PAR-CLIP	23592263
MIRT482111	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT482109	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT482110	hsa-miR-646	PAR-CLIP	23592263
MIRT482108	hsa-miR-3976	PAR-CLIP	23592263
MIRT482107	hsa-miR-4781-3p	PAR-CLIP	23592263
MIRT482106	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT482105	hsa-miR-520h	PAR-CLIP	23592263
MIRT482104	hsa-miR-545-3p	PAR-CLIP	23592263
MIRT482103	hsa-miR-4725-5p	PAR-CLIP	23592263
MIRT482102	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT482101	hsa-miR-6134	PAR-CLIP	23592263
MIRT482100	hsa-miR-567	PAR-CLIP	23592263
MIRT482099	hsa-miR-223-5p	PAR-CLIP	23592263
MIRT482098	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT482097	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT482095	hsa-miR-2054	PAR-CLIP	23592263
MIRT482096	hsa-miR-297	PAR-CLIP	23592263
MIRT776683	hsa-miR-1206	CLIP-seq
MIRT776684	hsa-miR-1225-3p	CLIP-seq
MIRT776685	hsa-miR-1233	CLIP-seq
MIRT776686	hsa-miR-1236	CLIP-seq
MIRT776687	hsa-miR-134	CLIP-seq
MIRT776688	hsa-miR-149	CLIP-seq
MIRT776689	hsa-miR-150	CLIP-seq
MIRT776690	hsa-miR-15a	CLIP-seq
MIRT776691	hsa-miR-15b	CLIP-seq
MIRT776692	hsa-miR-16	CLIP-seq
MIRT776693	hsa-miR-195	CLIP-seq
MIRT776694	hsa-miR-24	CLIP-seq
MIRT776695	hsa-miR-3064-3p	CLIP-seq
MIRT776696	hsa-miR-3064-5p	CLIP-seq
MIRT776697	hsa-miR-3118	CLIP-seq
MIRT776698	hsa-miR-3136-5p	CLIP-seq
MIRT776699	hsa-miR-3153	CLIP-seq
MIRT776700	hsa-miR-3177-5p	CLIP-seq
MIRT776701	hsa-miR-320e	CLIP-seq
MIRT776702	hsa-miR-326	CLIP-seq
MIRT776703	hsa-miR-330-3p	CLIP-seq
MIRT776704	hsa-miR-330-5p	CLIP-seq
MIRT776705	hsa-miR-3617	CLIP-seq
MIRT776706	hsa-miR-362-5p	CLIP-seq
MIRT776707	hsa-miR-3653	CLIP-seq
MIRT776708	hsa-miR-3658	CLIP-seq
MIRT776709	hsa-miR-371-5p	CLIP-seq
MIRT776710	hsa-miR-371b-5p	CLIP-seq
MIRT776711	hsa-miR-424	CLIP-seq
MIRT776712	hsa-miR-4284	CLIP-seq
MIRT776713	hsa-miR-4307	CLIP-seq
MIRT776714	hsa-miR-4323	CLIP-seq
MIRT776715	hsa-miR-4439	CLIP-seq
MIRT776716	hsa-miR-4474-5p	CLIP-seq
MIRT776717	hsa-miR-4513	CLIP-seq
MIRT776718	hsa-miR-4524	CLIP-seq
MIRT776719	hsa-miR-4645-3p	CLIP-seq
MIRT776720	hsa-miR-4698	CLIP-seq
MIRT776721	hsa-miR-4713-5p	CLIP-seq
MIRT776722	hsa-miR-4715-3p	CLIP-seq
MIRT776723	hsa-miR-4717-3p	CLIP-seq
MIRT776724	hsa-miR-4776-3p	CLIP-seq
MIRT776725	hsa-miR-4778-3p	CLIP-seq
MIRT776726	hsa-miR-4794	CLIP-seq
MIRT776727	hsa-miR-497	CLIP-seq
MIRT776728	hsa-miR-500a	CLIP-seq
MIRT776729	hsa-miR-500b	CLIP-seq
MIRT776730	hsa-miR-502-5p	CLIP-seq
MIRT776731	hsa-miR-503	CLIP-seq
MIRT776732	hsa-miR-513c	CLIP-seq
MIRT776733	hsa-miR-514b-5p	CLIP-seq
MIRT776734	hsa-miR-532-3p	CLIP-seq
MIRT776735	hsa-miR-548c-3p	CLIP-seq
MIRT776736	hsa-miR-576-3p	CLIP-seq
MIRT776737	hsa-miR-579	CLIP-seq
MIRT776738	hsa-miR-875-3p	CLIP-seq
MIRT776739	hsa-miR-888	CLIP-seq
MIRT776740	hsa-miR-942	CLIP-seq
MIRT776741	hsa-miR-203	CLIP-seq
MIRT776742	hsa-miR-501-3p	CLIP-seq
MIRT776743	hsa-miR-502-3p	CLIP-seq
MIRT776684	hsa-miR-1225-3p	CLIP-seq
MIRT776685	hsa-miR-1233	CLIP-seq
MIRT1545265	hsa-miR-1289	CLIP-seq
MIRT1545266	hsa-miR-1292	CLIP-seq
MIRT1545267	hsa-miR-1587	CLIP-seq
MIRT1545268	hsa-miR-199a-5p	CLIP-seq
MIRT1545269	hsa-miR-199b-5p	CLIP-seq
MIRT1545270	hsa-miR-2276	CLIP-seq
MIRT1545271	hsa-miR-3135b	CLIP-seq
MIRT1545272	hsa-miR-3198	CLIP-seq
MIRT1545273	hsa-miR-3545-3p	CLIP-seq
MIRT1545274	hsa-miR-3622b-5p	CLIP-seq
MIRT1545275	hsa-miR-3652	CLIP-seq
MIRT1545276	hsa-miR-4294	CLIP-seq
MIRT1545277	hsa-miR-4302	CLIP-seq
MIRT1545278	hsa-miR-4309	CLIP-seq
MIRT776714	hsa-miR-4323	CLIP-seq
MIRT1545279	hsa-miR-4430	CLIP-seq
MIRT1545280	hsa-miR-4471	CLIP-seq
MIRT1545281	hsa-miR-4492	CLIP-seq
MIRT1545282	hsa-miR-4498	CLIP-seq
MIRT1545283	hsa-miR-4505	CLIP-seq
MIRT1545284	hsa-miR-4539	CLIP-seq
MIRT776719	hsa-miR-4645-3p	CLIP-seq
MIRT1545285	hsa-miR-4645-5p	CLIP-seq
MIRT1545286	hsa-miR-4646-5p	CLIP-seq
MIRT1545287	hsa-miR-4656	CLIP-seq
MIRT1545288	hsa-miR-4673	CLIP-seq
MIRT1545289	hsa-miR-4675	CLIP-seq
MIRT1545290	hsa-miR-4676-5p	CLIP-seq
MIRT1545291	hsa-miR-4699-5p	CLIP-seq
MIRT1545292	hsa-miR-4741	CLIP-seq
MIRT1545293	hsa-miR-4772-3p	CLIP-seq
MIRT1545294	hsa-miR-518a-5p	CLIP-seq
MIRT1545295	hsa-miR-527	CLIP-seq
MIRT1545296	hsa-miR-575	CLIP-seq
MIRT1545297	hsa-miR-762	CLIP-seq
MIRT776690	hsa-miR-15a	CLIP-seq
MIRT776691	hsa-miR-15b	CLIP-seq
MIRT776692	hsa-miR-16	CLIP-seq
MIRT776693	hsa-miR-195	CLIP-seq
MIRT776711	hsa-miR-424	CLIP-seq
MIRT776718	hsa-miR-4524	CLIP-seq
MIRT776719	hsa-miR-4645-3p	CLIP-seq
MIRT1920241	hsa-miR-4786-5p	CLIP-seq
MIRT776727	hsa-miR-497	CLIP-seq
MIRT776731	hsa-miR-503	CLIP-seq
MIRT1920242	hsa-miR-769-5p	CLIP-seq
MIRT776690	hsa-miR-15a	CLIP-seq
MIRT776691	hsa-miR-15b	CLIP-seq
MIRT776692	hsa-miR-16	CLIP-seq
MIRT776693	hsa-miR-195	CLIP-seq
MIRT776711	hsa-miR-424	CLIP-seq
MIRT776718	hsa-miR-4524	CLIP-seq
MIRT776719	hsa-miR-4645-3p	CLIP-seq
MIRT1920241	hsa-miR-4786-5p	CLIP-seq
MIRT776727	hsa-miR-497	CLIP-seq
MIRT776731	hsa-miR-503	CLIP-seq
MIRT1920242	hsa-miR-769-5p	CLIP-seq
MIRT1929347	hsa-miR-1231	CLIP-seq
MIRT1929348	hsa-miR-1245	CLIP-seq
MIRT1929349	hsa-miR-129-5p	CLIP-seq
MIRT776688	hsa-miR-149	CLIP-seq
MIRT1929350	hsa-miR-27a	CLIP-seq
MIRT1929351	hsa-miR-27b	CLIP-seq
MIRT776696	hsa-miR-3064-5p	CLIP-seq
MIRT1929352	hsa-miR-3117-3p	CLIP-seq
MIRT1929353	hsa-miR-3120-5p	CLIP-seq
MIRT1929354	hsa-miR-3169	CLIP-seq
MIRT1929355	hsa-miR-361-3p	CLIP-seq
MIRT1929356	hsa-miR-3978	CLIP-seq
MIRT1929357	hsa-miR-409-3p	CLIP-seq
MIRT1929358	hsa-miR-4418	CLIP-seq
MIRT1929359	hsa-miR-4733-3p	CLIP-seq
MIRT1929360	hsa-miR-4759	CLIP-seq
MIRT776726	hsa-miR-4794	CLIP-seq
MIRT1929361	hsa-miR-509-3-5p	CLIP-seq
MIRT1929362	hsa-miR-509-5p	CLIP-seq
MIRT1929363	hsa-miR-513a-5p	CLIP-seq
MIRT1929364	hsa-miR-663b	CLIP-seq
MIRT776690	hsa-miR-15a	CLIP-seq
MIRT776691	hsa-miR-15b	CLIP-seq
MIRT776692	hsa-miR-16	CLIP-seq
MIRT776693	hsa-miR-195	CLIP-seq
MIRT2169885	hsa-miR-29a	CLIP-seq
MIRT2169886	hsa-miR-29b	CLIP-seq
MIRT2169887	hsa-miR-29c	CLIP-seq
MIRT776698	hsa-miR-3136-5p	CLIP-seq
MIRT2169888	hsa-miR-3148	CLIP-seq
MIRT776699	hsa-miR-3153	CLIP-seq
MIRT776700	hsa-miR-3177-5p	CLIP-seq
MIRT776705	hsa-miR-3617	CLIP-seq
MIRT2169889	hsa-miR-3688-3p	CLIP-seq
MIRT776709	hsa-miR-371-5p	CLIP-seq
MIRT776710	hsa-miR-371b-5p	CLIP-seq
MIRT2169890	hsa-miR-3974	CLIP-seq
MIRT776711	hsa-miR-424	CLIP-seq
MIRT2169891	hsa-miR-4270	CLIP-seq
MIRT2169892	hsa-miR-4320	CLIP-seq
MIRT2169893	hsa-miR-433	CLIP-seq
MIRT776715	hsa-miR-4439	CLIP-seq
MIRT2169894	hsa-miR-4441	CLIP-seq
MIRT2169895	hsa-miR-4450	CLIP-seq
MIRT2169896	hsa-miR-448	CLIP-seq
MIRT776718	hsa-miR-4524	CLIP-seq
MIRT2169897	hsa-miR-4633-5p	CLIP-seq
MIRT2169898	hsa-miR-4668-5p	CLIP-seq
MIRT2169899	hsa-miR-4694-3p	CLIP-seq
MIRT776720	hsa-miR-4698	CLIP-seq
MIRT776727	hsa-miR-497	CLIP-seq
MIRT776731	hsa-miR-503	CLIP-seq
MIRT776732	hsa-miR-513c	CLIP-seq
MIRT776733	hsa-miR-514b-5p	CLIP-seq
MIRT2169900	hsa-miR-532-5p	CLIP-seq
MIRT2169901	hsa-miR-570	CLIP-seq
MIRT776737	hsa-miR-579	CLIP-seq
MIRT2169902	hsa-miR-664	CLIP-seq
MIRT1920242	hsa-miR-769-5p	CLIP-seq
MIRT1929347	hsa-miR-1231	CLIP-seq
MIRT1545265	hsa-miR-1289	CLIP-seq
MIRT776688	hsa-miR-149	CLIP-seq
MIRT776696	hsa-miR-3064-5p	CLIP-seq
MIRT1929353	hsa-miR-3120-5p	CLIP-seq
MIRT1545272	hsa-miR-3198	CLIP-seq
MIRT2384059	hsa-miR-4257	CLIP-seq
MIRT1545276	hsa-miR-4294	CLIP-seq
MIRT1545278	hsa-miR-4309	CLIP-seq
MIRT2384060	hsa-miR-4330	CLIP-seq
MIRT1929359	hsa-miR-4733-3p	CLIP-seq
MIRT776726	hsa-miR-4794	CLIP-seq
MIRT2384061	hsa-miR-586	CLIP-seq
MIRT2426167	hsa-miR-105	CLIP-seq
MIRT2426168	hsa-miR-1237	CLIP-seq
MIRT1929348	hsa-miR-1245	CLIP-seq
MIRT2426169	hsa-miR-1248	CLIP-seq
MIRT2426170	hsa-miR-181a	CLIP-seq
MIRT2426171	hsa-miR-181b	CLIP-seq
MIRT2426172	hsa-miR-181c	CLIP-seq
MIRT2426173	hsa-miR-181d	CLIP-seq
MIRT2426174	hsa-miR-1910	CLIP-seq
MIRT2426175	hsa-miR-2115	CLIP-seq
MIRT2426176	hsa-miR-3606	CLIP-seq
MIRT2426177	hsa-miR-3689a-5p	CLIP-seq
MIRT2426178	hsa-miR-3689b	CLIP-seq
MIRT2426179	hsa-miR-3689e	CLIP-seq
MIRT2426180	hsa-miR-3689f	CLIP-seq
MIRT2426181	hsa-miR-4262	CLIP-seq
MIRT2426182	hsa-miR-455-3p	CLIP-seq
MIRT2169897	hsa-miR-4633-5p	CLIP-seq
MIRT2426183	hsa-miR-4691-3p	CLIP-seq
MIRT2426184	hsa-miR-516a-3p	CLIP-seq
MIRT2169900	hsa-miR-532-5p	CLIP-seq
MIRT2426185	hsa-miR-921	CLIP-seq
MIRT2435298	hsa-miR-154	CLIP-seq
MIRT2435299	hsa-miR-23a	CLIP-seq
MIRT2435300	hsa-miR-23b	CLIP-seq
MIRT2435301	hsa-miR-23c	CLIP-seq
MIRT2435302	hsa-miR-300	CLIP-seq
MIRT2435303	hsa-miR-374c	CLIP-seq
MIRT2435304	hsa-miR-381	CLIP-seq
MIRT2435305	hsa-miR-4666-3p	CLIP-seq
MIRT2435306	hsa-miR-4738-5p	CLIP-seq
MIRT2435307	hsa-miR-4789-5p	CLIP-seq
MIRT2435308	hsa-miR-605	CLIP-seq
MIRT2435309	hsa-miR-624	CLIP-seq
MIRT2435310	hsa-miR-655	CLIP-seq
MIRT2443526	hsa-miR-1251	CLIP-seq
MIRT2443527	hsa-miR-135a	CLIP-seq
MIRT2443528	hsa-miR-135b	CLIP-seq
MIRT2443529	hsa-miR-217	CLIP-seq
MIRT2443530	hsa-miR-3942-3p	CLIP-seq
MIRT776713	hsa-miR-4307	CLIP-seq
MIRT1929358	hsa-miR-4418	CLIP-seq
MIRT2443531	hsa-miR-4468	CLIP-seq
MIRT2443532	hsa-miR-4522	CLIP-seq
MIRT2443533	hsa-miR-4663	CLIP-seq
MIRT1929361	hsa-miR-509-3-5p	CLIP-seq
MIRT1929362	hsa-miR-509-5p	CLIP-seq
MIRT2472701	hsa-miR-101	CLIP-seq
MIRT2472702	hsa-miR-1202	CLIP-seq
MIRT776683	hsa-miR-1206	CLIP-seq
MIRT776684	hsa-miR-1225-3p	CLIP-seq
MIRT1929347	hsa-miR-1231	CLIP-seq
MIRT776685	hsa-miR-1233	CLIP-seq
MIRT2443526	hsa-miR-1251	CLIP-seq
MIRT2472703	hsa-miR-1252	CLIP-seq
MIRT2472704	hsa-miR-1265	CLIP-seq
MIRT2472705	hsa-miR-1273e	CLIP-seq
MIRT2472706	hsa-miR-128	CLIP-seq
MIRT1545265	hsa-miR-1289	CLIP-seq
MIRT1545266	hsa-miR-1292	CLIP-seq
MIRT2472707	hsa-miR-1294	CLIP-seq
MIRT2472708	hsa-miR-1298	CLIP-seq
MIRT2472709	hsa-miR-1303	CLIP-seq
MIRT2472710	hsa-miR-1321	CLIP-seq
MIRT2443527	hsa-miR-135a	CLIP-seq
MIRT2443528	hsa-miR-135b	CLIP-seq
MIRT2472711	hsa-miR-142-5p	CLIP-seq
MIRT2472712	hsa-miR-148a	CLIP-seq
MIRT2472713	hsa-miR-148b	CLIP-seq
MIRT776688	hsa-miR-149	CLIP-seq
MIRT2472714	hsa-miR-152	CLIP-seq
MIRT2472715	hsa-miR-1538	CLIP-seq
MIRT2435298	hsa-miR-154	CLIP-seq
MIRT1545267	hsa-miR-1587	CLIP-seq
MIRT2472716	hsa-miR-1825	CLIP-seq
MIRT1545268	hsa-miR-199a-5p	CLIP-seq
MIRT1545269	hsa-miR-199b-5p	CLIP-seq
MIRT2472717	hsa-miR-205	CLIP-seq
MIRT2472718	hsa-miR-223	CLIP-seq
MIRT1545270	hsa-miR-2276	CLIP-seq
MIRT1929350	hsa-miR-27a	CLIP-seq
MIRT1929351	hsa-miR-27b	CLIP-seq
MIRT776696	hsa-miR-3064-5p	CLIP-seq
MIRT1929353	hsa-miR-3120-5p	CLIP-seq
MIRT1545271	hsa-miR-3135b	CLIP-seq
MIRT2472719	hsa-miR-3146	CLIP-seq
MIRT2472720	hsa-miR-3150b-3p	CLIP-seq
MIRT2472721	hsa-miR-3151	CLIP-seq
MIRT2472722	hsa-miR-3152-5p	CLIP-seq
MIRT2472723	hsa-miR-3157-5p	CLIP-seq
MIRT776700	hsa-miR-3177-5p	CLIP-seq
MIRT2472724	hsa-miR-3187-3p	CLIP-seq
MIRT2472725	hsa-miR-3189-3p	CLIP-seq
MIRT1545272	hsa-miR-3198	CLIP-seq
MIRT2472726	hsa-miR-320b	CLIP-seq
MIRT2472727	hsa-miR-320c	CLIP-seq
MIRT2472728	hsa-miR-320d	CLIP-seq
MIRT776701	hsa-miR-320e	CLIP-seq
MIRT2472729	hsa-miR-340	CLIP-seq
MIRT2472730	hsa-miR-345	CLIP-seq
MIRT2472731	hsa-miR-34b	CLIP-seq
MIRT1545273	hsa-miR-3545-3p	CLIP-seq
MIRT2472732	hsa-miR-3616-5p	CLIP-seq
MIRT1545274	hsa-miR-3622b-5p	CLIP-seq
MIRT2472733	hsa-miR-3646	CLIP-seq
MIRT2472734	hsa-miR-3647-5p	CLIP-seq
MIRT1545275	hsa-miR-3652	CLIP-seq
MIRT776707	hsa-miR-3653	CLIP-seq
MIRT776708	hsa-miR-3658	CLIP-seq
MIRT2472735	hsa-miR-3663-5p	CLIP-seq
MIRT2472736	hsa-miR-3677-5p	CLIP-seq
MIRT2472737	hsa-miR-3680	CLIP-seq
MIRT2472738	hsa-miR-376a	CLIP-seq
MIRT2472739	hsa-miR-376b	CLIP-seq
MIRT2472740	hsa-miR-3926	CLIP-seq
MIRT2443530	hsa-miR-3942-3p	CLIP-seq
MIRT2472741	hsa-miR-3944-3p	CLIP-seq
MIRT2472742	hsa-miR-3972	CLIP-seq
MIRT2169890	hsa-miR-3974	CLIP-seq
MIRT2472743	hsa-miR-412	CLIP-seq
MIRT2384059	hsa-miR-4257	CLIP-seq
MIRT2169891	hsa-miR-4270	CLIP-seq
MIRT2472744	hsa-miR-4275	CLIP-seq
MIRT2472745	hsa-miR-4281	CLIP-seq
MIRT2472746	hsa-miR-4283	CLIP-seq
MIRT2472747	hsa-miR-4292	CLIP-seq
MIRT1545276	hsa-miR-4294	CLIP-seq
MIRT1545277	hsa-miR-4302	CLIP-seq
MIRT776713	hsa-miR-4307	CLIP-seq
MIRT2472748	hsa-miR-4308	CLIP-seq
MIRT1545278	hsa-miR-4309	CLIP-seq
MIRT2472749	hsa-miR-4316	CLIP-seq
MIRT776714	hsa-miR-4323	CLIP-seq
MIRT2384060	hsa-miR-4330	CLIP-seq
MIRT2472750	hsa-miR-4423-5p	CLIP-seq
MIRT2472751	hsa-miR-4429	CLIP-seq
MIRT1545279	hsa-miR-4430	CLIP-seq
MIRT2472752	hsa-miR-4435	CLIP-seq
MIRT2169894	hsa-miR-4441	CLIP-seq
MIRT2443531	hsa-miR-4468	CLIP-seq
MIRT1545280	hsa-miR-4471	CLIP-seq
MIRT2472753	hsa-miR-4473	CLIP-seq
MIRT2472754	hsa-miR-4487	CLIP-seq
MIRT2472755	hsa-miR-4489	CLIP-seq
MIRT2472756	hsa-miR-4491	CLIP-seq
MIRT1545281	hsa-miR-4492	CLIP-seq
MIRT1545282	hsa-miR-4498	CLIP-seq
MIRT2472757	hsa-miR-4503	CLIP-seq
MIRT1545283	hsa-miR-4505	CLIP-seq
MIRT2472758	hsa-miR-4521	CLIP-seq
MIRT2443532	hsa-miR-4522	CLIP-seq
MIRT1545284	hsa-miR-4539	CLIP-seq
MIRT2472759	hsa-miR-4633-3p	CLIP-seq
MIRT2472760	hsa-miR-4635	CLIP-seq
MIRT2472761	hsa-miR-4639-3p	CLIP-seq
MIRT2472762	hsa-miR-4643	CLIP-seq
MIRT776719	hsa-miR-4645-3p	CLIP-seq
MIRT1545285	hsa-miR-4645-5p	CLIP-seq
MIRT1545286	hsa-miR-4646-5p	CLIP-seq
MIRT1545287	hsa-miR-4656	CLIP-seq
MIRT2472763	hsa-miR-4657	CLIP-seq
MIRT2472764	hsa-miR-4659a-3p	CLIP-seq
MIRT2472765	hsa-miR-4659b-3p	CLIP-seq
MIRT2472766	hsa-miR-466	CLIP-seq
MIRT2443533	hsa-miR-4663	CLIP-seq
MIRT2435305	hsa-miR-4666-3p	CLIP-seq
MIRT2472767	hsa-miR-4670-3p	CLIP-seq
MIRT1545288	hsa-miR-4673	CLIP-seq
MIRT1545289	hsa-miR-4675	CLIP-seq
MIRT1545290	hsa-miR-4676-5p	CLIP-seq
MIRT2472768	hsa-miR-4686	CLIP-seq
MIRT2472769	hsa-miR-4689	CLIP-seq
MIRT2426183	hsa-miR-4691-3p	CLIP-seq
MIRT2472770	hsa-miR-4697-3p	CLIP-seq
MIRT2472771	hsa-miR-4701-5p	CLIP-seq
MIRT2472772	hsa-miR-4707-3p	CLIP-seq
MIRT2472773	hsa-miR-4719	CLIP-seq
MIRT2472774	hsa-miR-4739	CLIP-seq
MIRT1545292	hsa-miR-4741	CLIP-seq
MIRT2472775	hsa-miR-4742-3p	CLIP-seq
MIRT2472776	hsa-miR-4745-3p	CLIP-seq
MIRT2472777	hsa-miR-4755-3p	CLIP-seq
MIRT2472778	hsa-miR-4756-5p	CLIP-seq
MIRT2472779	hsa-miR-4760-3p	CLIP-seq
MIRT2472780	hsa-miR-4767	CLIP-seq
MIRT1545293	hsa-miR-4772-3p	CLIP-seq
MIRT2472781	hsa-miR-4784	CLIP-seq
MIRT1920241	hsa-miR-4786-5p	CLIP-seq
MIRT2472782	hsa-miR-4789-3p	CLIP-seq
MIRT2435307	hsa-miR-4789-5p	CLIP-seq
MIRT776726	hsa-miR-4794	CLIP-seq
MIRT2472783	hsa-miR-486-3p	CLIP-seq
MIRT2472784	hsa-miR-487a	CLIP-seq
MIRT2472785	hsa-miR-510	CLIP-seq
MIRT2472786	hsa-miR-512-3p	CLIP-seq
MIRT1929363	hsa-miR-513a-5p	CLIP-seq
MIRT1545294	hsa-miR-518a-5p	CLIP-seq
MIRT2472787	hsa-miR-520f	CLIP-seq
MIRT1545295	hsa-miR-527	CLIP-seq
MIRT776735	hsa-miR-548c-3p	CLIP-seq
MIRT2472788	hsa-miR-548s	CLIP-seq
MIRT2472789	hsa-miR-548v	CLIP-seq
MIRT2472790	hsa-miR-573	CLIP-seq
MIRT1545296	hsa-miR-575	CLIP-seq
MIRT2472791	hsa-miR-588	CLIP-seq
MIRT2472792	hsa-miR-596	CLIP-seq
MIRT2435308	hsa-miR-605	CLIP-seq
MIRT2472793	hsa-miR-626	CLIP-seq
MIRT2472794	hsa-miR-630	CLIP-seq
MIRT2472795	hsa-miR-661	CLIP-seq
MIRT1929364	hsa-miR-663b	CLIP-seq
MIRT1545297	hsa-miR-762	CLIP-seq
MIRT2472796	hsa-miR-767-3p	CLIP-seq
MIRT1920242	hsa-miR-769-5p	CLIP-seq
MIRT2472797	hsa-miR-877	CLIP-seq
MIRT2472701	hsa-miR-101	CLIP-seq
MIRT776683	hsa-miR-1206	CLIP-seq
MIRT776684	hsa-miR-1225-3p	CLIP-seq
MIRT1929347	hsa-miR-1231	CLIP-seq
MIRT776685	hsa-miR-1233	CLIP-seq
MIRT2443526	hsa-miR-1251	CLIP-seq
MIRT2472703	hsa-miR-1252	CLIP-seq
MIRT2472705	hsa-miR-1273e	CLIP-seq
MIRT2472706	hsa-miR-128	CLIP-seq
MIRT1545265	hsa-miR-1289	CLIP-seq
MIRT1545266	hsa-miR-1292	CLIP-seq
MIRT2472707	hsa-miR-1294	CLIP-seq
MIRT2472708	hsa-miR-1298	CLIP-seq
MIRT2674876	hsa-miR-1305	CLIP-seq
MIRT2472710	hsa-miR-1321	CLIP-seq
MIRT2443527	hsa-miR-135a	CLIP-seq
MIRT2443528	hsa-miR-135b	CLIP-seq
MIRT2472711	hsa-miR-142-5p	CLIP-seq
MIRT2472712	hsa-miR-148a	CLIP-seq
MIRT2472713	hsa-miR-148b	CLIP-seq
MIRT776688	hsa-miR-149	CLIP-seq
MIRT2472714	hsa-miR-152	CLIP-seq
MIRT2472715	hsa-miR-1538	CLIP-seq
MIRT2435298	hsa-miR-154	CLIP-seq
MIRT1545267	hsa-miR-1587	CLIP-seq
MIRT1545268	hsa-miR-199a-5p	CLIP-seq
MIRT1545269	hsa-miR-199b-5p	CLIP-seq
MIRT2472717	hsa-miR-205	CLIP-seq
MIRT2472718	hsa-miR-223	CLIP-seq
MIRT1545270	hsa-miR-2276	CLIP-seq
MIRT1929350	hsa-miR-27a	CLIP-seq
MIRT1929351	hsa-miR-27b	CLIP-seq
MIRT776696	hsa-miR-3064-5p	CLIP-seq
MIRT1929353	hsa-miR-3120-5p	CLIP-seq
MIRT1545271	hsa-miR-3135b	CLIP-seq
MIRT2472719	hsa-miR-3146	CLIP-seq
MIRT2472720	hsa-miR-3150b-3p	CLIP-seq
MIRT2472721	hsa-miR-3151	CLIP-seq
MIRT2472722	hsa-miR-3152-5p	CLIP-seq
MIRT2472723	hsa-miR-3157-5p	CLIP-seq
MIRT1545272	hsa-miR-3198	CLIP-seq
MIRT2472726	hsa-miR-320b	CLIP-seq
MIRT2472727	hsa-miR-320c	CLIP-seq
MIRT2472728	hsa-miR-320d	CLIP-seq
MIRT776701	hsa-miR-320e	CLIP-seq
MIRT2472729	hsa-miR-340	CLIP-seq
MIRT2472730	hsa-miR-345	CLIP-seq
MIRT1545273	hsa-miR-3545-3p	CLIP-seq
MIRT2472732	hsa-miR-3616-5p	CLIP-seq
MIRT1545274	hsa-miR-3622b-5p	CLIP-seq
MIRT2472734	hsa-miR-3647-5p	CLIP-seq
MIRT1545275	hsa-miR-3652	CLIP-seq
MIRT2472735	hsa-miR-3663-5p	CLIP-seq
MIRT2472736	hsa-miR-3677-5p	CLIP-seq
MIRT2472737	hsa-miR-3680	CLIP-seq
MIRT2674877	hsa-miR-3691-5p	CLIP-seq
MIRT2443530	hsa-miR-3942-3p	CLIP-seq
MIRT2472741	hsa-miR-3944-3p	CLIP-seq
MIRT2472743	hsa-miR-412	CLIP-seq
MIRT2384059	hsa-miR-4257	CLIP-seq
MIRT2169891	hsa-miR-4270	CLIP-seq
MIRT2472744	hsa-miR-4275	CLIP-seq
MIRT2472745	hsa-miR-4281	CLIP-seq
MIRT2472746	hsa-miR-4283	CLIP-seq
MIRT2472747	hsa-miR-4292	CLIP-seq
MIRT1545276	hsa-miR-4294	CLIP-seq
MIRT1545277	hsa-miR-4302	CLIP-seq
MIRT776713	hsa-miR-4307	CLIP-seq
MIRT2472748	hsa-miR-4308	CLIP-seq
MIRT1545278	hsa-miR-4309	CLIP-seq
MIRT2472749	hsa-miR-4316	CLIP-seq
MIRT776714	hsa-miR-4323	CLIP-seq
MIRT2384060	hsa-miR-4330	CLIP-seq
MIRT2472751	hsa-miR-4429	CLIP-seq
MIRT1545279	hsa-miR-4430	CLIP-seq
MIRT2169894	hsa-miR-4441	CLIP-seq
MIRT2674878	hsa-miR-4443	CLIP-seq
MIRT2443531	hsa-miR-4468	CLIP-seq
MIRT1545280	hsa-miR-4471	CLIP-seq
MIRT2472753	hsa-miR-4473	CLIP-seq
MIRT2674879	hsa-miR-4480	CLIP-seq
MIRT2472754	hsa-miR-4487	CLIP-seq
MIRT2472755	hsa-miR-4489	CLIP-seq
MIRT2472756	hsa-miR-4491	CLIP-seq
MIRT1545281	hsa-miR-4492	CLIP-seq
MIRT1545282	hsa-miR-4498	CLIP-seq
MIRT2472757	hsa-miR-4503	CLIP-seq
MIRT1545283	hsa-miR-4505	CLIP-seq
MIRT2443532	hsa-miR-4522	CLIP-seq
MIRT1545284	hsa-miR-4539	CLIP-seq
MIRT2472759	hsa-miR-4633-3p	CLIP-seq
MIRT2472760	hsa-miR-4635	CLIP-seq
MIRT2472761	hsa-miR-4639-3p	CLIP-seq
MIRT2472762	hsa-miR-4643	CLIP-seq
MIRT776719	hsa-miR-4645-3p	CLIP-seq
MIRT1545285	hsa-miR-4645-5p	CLIP-seq
MIRT1545286	hsa-miR-4646-5p	CLIP-seq
MIRT1545287	hsa-miR-4656	CLIP-seq
MIRT2472763	hsa-miR-4657	CLIP-seq
MIRT2472766	hsa-miR-466	CLIP-seq
MIRT2443533	hsa-miR-4663	CLIP-seq
MIRT2472767	hsa-miR-4670-3p	CLIP-seq
MIRT1545288	hsa-miR-4673	CLIP-seq
MIRT1545289	hsa-miR-4675	CLIP-seq
MIRT1545290	hsa-miR-4676-5p	CLIP-seq
MIRT2472768	hsa-miR-4686	CLIP-seq
MIRT2472769	hsa-miR-4689	CLIP-seq
MIRT2426183	hsa-miR-4691-3p	CLIP-seq
MIRT2472770	hsa-miR-4697-3p	CLIP-seq
MIRT2472772	hsa-miR-4707-3p	CLIP-seq
MIRT2472773	hsa-miR-4719	CLIP-seq
MIRT2472774	hsa-miR-4739	CLIP-seq
MIRT1545292	hsa-miR-4741	CLIP-seq
MIRT2472775	hsa-miR-4742-3p	CLIP-seq
MIRT2472776	hsa-miR-4745-3p	CLIP-seq
MIRT2674880	hsa-miR-4752	CLIP-seq
MIRT2472778	hsa-miR-4756-5p	CLIP-seq
MIRT2472779	hsa-miR-4760-3p	CLIP-seq
MIRT2472780	hsa-miR-4767	CLIP-seq
MIRT1545293	hsa-miR-4772-3p	CLIP-seq
MIRT2472781	hsa-miR-4784	CLIP-seq
MIRT1920241	hsa-miR-4786-5p	CLIP-seq
MIRT2472782	hsa-miR-4789-3p	CLIP-seq
MIRT2435307	hsa-miR-4789-5p	CLIP-seq
MIRT776726	hsa-miR-4794	CLIP-seq
MIRT2472783	hsa-miR-486-3p	CLIP-seq
MIRT2472784	hsa-miR-487a	CLIP-seq
MIRT2472786	hsa-miR-512-3p	CLIP-seq
MIRT1929363	hsa-miR-513a-5p	CLIP-seq
MIRT1545294	hsa-miR-518a-5p	CLIP-seq
MIRT2472787	hsa-miR-520f	CLIP-seq
MIRT1545295	hsa-miR-527	CLIP-seq
MIRT776735	hsa-miR-548c-3p	CLIP-seq
MIRT2472789	hsa-miR-548v	CLIP-seq
MIRT2472790	hsa-miR-573	CLIP-seq
MIRT1545296	hsa-miR-575	CLIP-seq
MIRT2472792	hsa-miR-596	CLIP-seq
MIRT2435308	hsa-miR-605	CLIP-seq
MIRT2472793	hsa-miR-626	CLIP-seq
MIRT2472794	hsa-miR-630	CLIP-seq
MIRT2472795	hsa-miR-661	CLIP-seq
MIRT1929364	hsa-miR-663b	CLIP-seq
MIRT1545297	hsa-miR-762	CLIP-seq
MIRT2472796	hsa-miR-767-3p	CLIP-seq
MIRT1920242	hsa-miR-769-5p	CLIP-seq

Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	25323119
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	10092583
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	16540465
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	12176997, 17544405, 19713527, 20059950, 25036637, 25241761, 33961781
GO:0005524	Function	ATP binding	IDA	16540465
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005929	Component	Cilium	IDA
GO:0006468	Process	Protein phosphorylation	TAS	10092583
GO:0007165	Process	Signal transduction	IMP	18524868
GO:0007165	Process	Signal transduction	TAS	10092583
GO:0008286	Process	Insulin receptor signaling pathway	IBA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0032008	Process	Positive regulation of TOR signaling	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0036064	Component	Ciliary basal body	IDA
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IBA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	28254819
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045793	Process	Positive regulation of cell size	IEA
GO:0048854	Process	Brain morphogenesis	IEA
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IMP	25323119
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1903898	Process	Negative regulation of PERK-mediated unfolded protein response	IEA
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IDA	28254819
GO:1905653	Process	Positive regulation of artery morphogenesis	IEA
GO:2000773	Process	Negative regulation of cellular senescence	IMP	25323119

MIM	HGNC	e!Ensembl
611223	393	ENSG00000117020

Q9Y243

Protein name

RAC-gamma serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase Akt-3) (Protein kinase B gamma) (PKB gamma) (RAC-PK-gamma) (STK-2)

Protein function

AKT3 is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis. This is mediated throug

PDB

2X18 , 8ZXW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	6 → 107	PH domain	Domain
PF00069	Pkinase	148 → 405	Protein kinase domain	Domain
PF00433	Pkinase_C	426 → 473	Protein kinase C terminal domain	Family

Tissue specificity

TISSUE SPECIFICITY: In adult tissues, it is highly expressed in brain, lung and kidney, but weakly in heart, testis and liver. In fetal tissues, it is highly expressed in heart, liver and brain and not at all in kidney.

Sequence

MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE

Sequence length

479

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance Endocrine resistance Platinum drug resistance MAPK signaling pathway ErbB signaling pathway Ras signaling pathway Rap1 signaling pathway cGMP-PKG signaling pathway cAMP signaling pathway Chemokine signaling pathway HIF-1 signaling pathway FoxO signaling pathway Sphingolipid signaling pathway Phospholipase D signaling pathway Autophagy - animal mTOR signaling pathway PI3K-Akt signaling pathway AMPK signaling pathway Apoptosis Longevity regulating pathway Longevity regulating pathway - multiple species Cellular senescence Adrenergic signaling in cardiomyocytes VEGF signaling pathway Apelin signaling pathway Osteoclast differentiation Focal adhesion Signaling pathways regulating pluripotency of stem cells Platelet activation Neutrophil extracellular trap formation Toll-like receptor signaling pathway C-type lectin receptor signaling pathway JAK-STAT signaling pathway T cell receptor signaling pathway B cell receptor signaling pathway Fc epsilon RI signaling pathway Fc gamma R-mediated phagocytosis TNF signaling pathway Neurotrophin signaling pathway Cholinergic synapse Dopaminergic synapse Regulation of actin cytoskeleton Insulin signaling pathway Progesterone-mediated oocyte maturation Estrogen signaling pathway Prolactin signaling pathway Thyroid hormone signaling pathway Adipocytokine signaling pathway Glucagon signaling pathway Regulation of lipolysis in adipocytes Relaxin signaling pathway GnRH secretion Insulin resistance Non-alcoholic fatty liver disease AGE-RAGE signaling pathway in diabetic complications Growth hormone synthesis, secretion and action Alcoholic liver disease Carbohydrate digestion and absorption Alzheimer disease Spinocerebellar ataxia Shigellosis Salmonella infection Yersinia infection Chagas disease Toxoplasmosis Tuberculosis Hepatitis C Hepatitis B Measles Human cytomegalovirus infection Influenza A Human papillomavirus infection Human T-cell leukemia virus 1 infection Kaposi sarcoma-associated herpesvirus infection Herpes simplex virus 1 infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Pathways in cancer Proteoglycans in cancer Chemical carcinogenesis - receptor activation Chemical carcinogenesis - reactive oxygen species Colorectal cancer Renal cell carcinoma Pancreatic cancer Endometrial cancer Glioma Prostate cancer Melanoma Chronic myeloid leukemia Acute myeloid leukemia Small cell lung cancer Non-small cell lung cancer Breast cancer Hepatocellular carcinoma Gastric cancer Central carbon metabolism in cancer Choline metabolism in cancer PD-L1 expression and PD-1 checkpoint pathway in cancer Diabetic cardiomyopathy Lipid and atherosclerosis Fluid shear stress and atherosclerosis		PIP3 activates AKT signaling Downregulation of ERBB2:ERBB3 signaling AKT phosphorylates targets in the cytosol AKT phosphorylates targets in the nucleus Negative regulation of the PI3K/AKT network AKT-mediated inactivation of FOXO1A CD28 dependent PI3K/Akt signaling CTLA4 inhibitory signaling G beta:gamma signalling through PI3Kgamma VEGFR2 mediated vascular permeability TP53 Regulates Metabolic Genes Constitutive Signaling by AKT1 E17K in Cancer Regulation of TP53 Degradation Regulation of TP53 Activity through Acetylation Regulation of TP53 Activity through Association with Co-factors Cyclin E associated events during G1/S transition Cyclin A:Cdk2-associated events at S phase entry RAB GEFs exchange GTP for GDP on RABs Regulation of PTEN stability and activity Regulation of localization of FOXO transcription factors Estrogen-dependent nuclear events downstream of ESR-membrane signaling

141

Show/Hide Causal Diseases (12)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
AKT3-related disorder	Likely pathogenic; Pathogenic	rs587776935	RCV004532479
Capillary hemangioma	Likely pathogenic; Pathogenic	rs587776935	RCV000415230
Cns neuroblastoma with FOXR2 activation	Pathogenic	rs397514606	RCV006253706
Global developmental delay	Likely pathogenic; Pathogenic	rs587776935	RCV000415230
Macrocephaly	Likely pathogenic; Pathogenic	rs587776935	RCV000415230
Medulloblastoma	Pathogenic	rs397514606	RCV006253705
Megalencephaly-capillary malformation-polymicrogyria syndrome	Pathogenic	rs397514605	RCV000416600
Megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome 2	Likely pathogenic; Pathogenic	rs1064795602, rs2147921624, rs2147812145, rs2147921662, rs886041100, rs587776935, rs397514605, rs397514606, rs1673171921	RCV001376775 RCV001728019 RCV001775235 RCV001775452 RCV000258932 RCV005252914 RCV000033035 RCV000033036 RCV000033037 RCV001289464
Neoplasm	Likely pathogenic; Pathogenic	rs587776935	RCV004668745
Overgrowth syndrome and/or cerebral malformations due to abnormalities in MTOR pathway genes	Pathogenic	rs397514606	RCV001836719
Polymicrogyria	Likely pathogenic; Pathogenic	rs587776935	RCV000415230
See cases	Likely pathogenic; Pathogenic	rs587776935	RCV002251942

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Likely benign	rs80149251	RCV005905434
Ovarian serous cystadenocarcinoma	Likely benign	rs574680728, rs80149251	RCV005937090 RCV005905435
Papillary renal cell carcinoma type 1	Benign; Likely benign	rs1481058473	RCV005917770
Seizure	Uncertain significance	rs766197531	RCV005624449
Uterine corpus endometrial carcinoma	Likely benign	rs574680728	RCV005937091

Show/Hide Text Mining Associations (91)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	33220166
Atherosclerosis	Associate	34103010
Autistic Disorder	Associate	28969385
Brain Diseases	Associate	36226386
Breast Neoplasms	Associate	10419456, 22722202, 23929892, 25927147, 27297869, 28160548, 29636477, 31781306, 32444848, 37834358, 40403210
Burkitt Lymphoma	Associate	19759907
Carcinogenesis	Associate	28733453
Carcinoma Hepatocellular	Associate	25424347, 26002580, 33289700, 38033034
Carcinoma Non Small Cell Lung	Associate	30280779, 30873868, 34313353, 34596822
Carcinoma Ovarian Epithelial	Associate	26909918
Carcinoma Renal Cell	Associate	23378641
Carcinoma Renal Cell	Inhibit	31672157
Carcinoma Small Cell	Associate	25855050
Celiac Disease	Associate	35208504
Central Nervous System Vascular Malformations	Associate	22500628, 28969385, 35997716
Colorectal Neoplasms	Associate	26222778, 32453706, 34919787, 34950443, 36499586
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	28969385
COVID 19	Associate	37834358
Dementia	Associate	37834358
Developmental Disabilities	Associate	28969385, 37088138
Diabetes Mellitus Type 2	Associate	37680885
Endometrial Neoplasms	Associate	30442683, 33690729, 40090626
Esophageal Neoplasms	Associate	10908564
Focal cortical dysplasia of Taylor	Associate	36342087
GATA2 Deficiency	Associate	19965620
Gingival Diseases	Associate	31743516
Glioblastoma	Associate	17934521, 24967401, 25501707, 26782072
Glioma	Associate	19818351, 20167810, 27422127
Head and Neck Neoplasms	Associate	28733453
Hemimegalencephaly	Associate	22500628, 22729223, 23101622, 23319189, 31444548
Hepatitis C	Associate	15133472
Heredodegenerative Disorders Nervous System	Associate	22500628
Hirschsprung Disease	Associate	27903978
Hyperinsulinism	Associate	33690729
Hypertensive Nephropathy	Associate	33176720
Hypoglycemia	Associate	22729222
Inflammation	Associate	37731502
Intervertebral Disc Displacement	Associate	21590431
Leiomyoma	Associate	36771423
Lung Injury	Associate	37731502
Lung Neoplasms	Associate	25855050, 27048287, 28500316, 37731502
Malformations of Cortical Development	Associate	28969385
Megalancephaly Polymicrogyria Polydactyly Hydrocephalus Syndrome	Associate	22729224
Megalencephaly	Associate	22729224, 24939587, 28086757, 28969385
Melanoma	Associate	18813315, 20647317, 22549727, 25452114, 25595898, 28852061, 37931033
Meningioma	Associate	27548314
Microcephaly	Associate	28283832
Mitochondrial Diseases	Associate	33087445
Multiple Myeloma	Associate	33794982
Muscular Diseases	Associate	36613689
Myelodysplastic Syndromes	Associate	30787430
Myelodysplastic Syndromes	Stimulate	34944006
Neoplasm Metastasis	Associate	27048287, 30429477
Neoplasms	Associate	11571628, 14680486, 15133472, 16721361, 17426444, 19818351, 24338765, 25122428, 26701849, 26782072, 27048287, 27072269, 29228422, 29367689, 30442683 View all (9 more)
Neoplasms	Inhibit	27422127, 28705772, 34919787, 36282188
Neoplasms Second Primary	Stimulate	25807342
Neurocutaneous Syndromes	Associate	37088138
Neuroinflammatory Diseases	Associate	33220166
Nevus	Associate	22549727
Obesity	Associate	29367689
Oropharyngeal Neoplasms	Associate	28733453
Osteogenesis imperfecta type 2A	Associate	36226386
Ovarian Neoplasms	Associate	27629740, 31703725, 32878513, 37303048
Pancreatic Neoplasms	Associate	31646811
Periventricular Nodular Heterotopia	Associate	28969385
Personality Disorders	Associate	22546513
Pituitary Neoplasms	Associate	31655798
Pneumonia Ventilator Associated	Associate	37731502
Polymicrogyria	Associate	28969385
Prostatic Neoplasms	Associate	10419456, 16721361, 22546513
Prostatic Neoplasms Castration Resistant	Associate	26540468
Prostatitis	Associate	10419456
Pulmonary Arterial Hypertension	Associate	36640125
Respiratory Tract Diseases	Associate	37925496
Sarcoidosis	Associate	22984568
Sepsis	Associate	28296904
Simpson Golabi Behmel syndrome	Associate	22729222, 32500425
Small Cell Lung Carcinoma	Associate	25122428
Somatoform Disorders	Associate	22500628
Spinal Cord Injuries	Associate	34814294
Squamous Cell Carcinoma of Head and Neck	Associate	28733453, 33811778
Stomach Neoplasms	Associate	29228422, 31480991, 34983559
Tertiary Lymphoid Structures	Associate	31781306
Testicular Germ Cell Tumor	Associate	34882061
Thyroid Cancer Papillary	Associate	28849051
Triple Negative Breast Neoplasms	Associate	22722202, 28160548, 33495420, 37569854
Urinary Bladder Neoplasms	Associate	23698120, 26148825
Urologic Neoplasms	Associate	26397152
Uterine Cervical Neoplasms	Associate	30283446, 31293179
Vascular Diseases	Inhibit	36640125
Wilms Tumor	Associate	32572913

AKT3 (AKT serine/threonine kinase 3)