ZNF385D (zinc finger protein 385D)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79750
• Gene name: Zinc finger protein 385D
• Gene symbol: ZNF385D
• Synonyms (NCBI Gene): ZNF659
• Chromosome: 3
• Chromosome location: 3p24.3

miRNA Show/Hide all (60)

miRTarBase ID	miRNA	Experiments	Reference
MIRT714750	hsa-miR-5088-3p	HITS-CLIP	19536157
MIRT648956	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT648957	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT714749	hsa-miR-3124-3p	HITS-CLIP	19536157
MIRT648955	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT714748	hsa-miR-2355-5p	HITS-CLIP	19536157
MIRT714747	hsa-miR-623	HITS-CLIP	19536157
MIRT714746	hsa-miR-204-5p	HITS-CLIP	19536157
MIRT714745	hsa-miR-211-5p	HITS-CLIP	19536157
MIRT648954	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT714744	hsa-miR-4755-5p	HITS-CLIP	19536157
MIRT714743	hsa-miR-5006-3p	HITS-CLIP	19536157
MIRT648953	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT648952	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT648951	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT648956	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT648957	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT648955	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT648954	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT648953	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT648952	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT648951	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT714750	hsa-miR-5088-3p	HITS-CLIP	19536157
MIRT648956	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT648957	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT714749	hsa-miR-3124-3p	HITS-CLIP	19536157
MIRT648955	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT714748	hsa-miR-2355-5p	HITS-CLIP	19536157
MIRT714747	hsa-miR-623	HITS-CLIP	19536157
MIRT714746	hsa-miR-204-5p	HITS-CLIP	19536157
MIRT714745	hsa-miR-211-5p	HITS-CLIP	19536157
MIRT648954	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT714744	hsa-miR-4755-5p	HITS-CLIP	19536157
MIRT714743	hsa-miR-5006-3p	HITS-CLIP	19536157
MIRT648953	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT648952	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT648951	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT648956	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT648957	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT648955	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT648954	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT648953	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT648952	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT648951	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT1523650	hsa-miR-1224-3p	CLIP-seq
MIRT1523651	hsa-miR-1260	CLIP-seq
MIRT1523652	hsa-miR-1260b	CLIP-seq
MIRT1523653	hsa-miR-1280	CLIP-seq
MIRT1523654	hsa-miR-1470	CLIP-seq
MIRT1523655	hsa-miR-4469	CLIP-seq
MIRT1523656	hsa-miR-4667-3p	CLIP-seq
MIRT1523657	hsa-miR-532-3p	CLIP-seq
MIRT1523650	hsa-miR-1224-3p	CLIP-seq
MIRT1523651	hsa-miR-1260	CLIP-seq
MIRT1523652	hsa-miR-1260b	CLIP-seq
MIRT1523653	hsa-miR-1280	CLIP-seq
MIRT1523654	hsa-miR-1470	CLIP-seq
MIRT1523655	hsa-miR-4469	CLIP-seq
MIRT1523656	hsa-miR-4667-3p	CLIP-seq
MIRT1523657	hsa-miR-532-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 621200
• HGNC: 26191
• e!Ensembl: ENSG00000151789

Protein

• UniProt ID: Q9H6B1
• Protein name: Zinc finger protein 385D (Zinc finger protein 659)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12874	zf-met	267 → 291		Domain
  PF12874	zf-met	80 → 104		Domain
  PF12874	zf-met	204 → 228		Domain

• Sequence:

  MRNIMYFGGTCQSPALPALVRPPAPPLQPSLDIKPFLPFPLDTAAAVNLFPNFNAMDPIQ
  KAVINHTFGVPLPHRRKQIISCNICQLRFNSDSQAAAHYKGTKHAKKLKALEAMKNKQKS
  VTAKDSAKTTFTSITTNTINTSSDKTDGTAGTPAISTTTTVEIRKSSVMTTEITSKVEKS
  PTTATGNSSCPSTETEEEKAKRLLYCSLCKVAVNSASQLEAHNSGTKHKTMLEARNGSGT
  IKAFPRAGVKGKGPVNKGNTGLQNKTFHCEICDVHVNSETQLKQHISSRRHKDRAAGKPP
  KPKYSPYNKLQKTAHPLGVKLVFSKEPSKPLAPRILPNPLAAAAAAAAVAVSSPFSLRTA
  PAATLFQTSALPPALLRPAPGPIRTAHTPVLFAPY

• Sequence length: 395

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (20)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	40708016	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	18316681	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	40050429, 40645996	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	18821565	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	18711365, 20351715	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	35157032	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	35157032	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	40708016	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLBLADDER DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	33293549	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	34586374, 41233554	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOYAMOYA DISEASE	—	GWAS catalog	37365321	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARTIAL EPILEPSY	—	GWAS catalog	20522523	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	35396580	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT RESISTANT DEPRESSION	—	GWAS catalog	30468137	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	38162683	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	35893037, 39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (9)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Bipolar Disorder	Bipolar disorder	Pubtator	24387768	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31322274	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	BEFREE	24024963		★☆☆☆☆ Found in Text Mining only
Language Disorders	Language Disorders	BEFREE	24024963		★☆☆☆☆ Found in Text Mining only
Language Disorders	Language development disorders	Pubtator	24024963	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31322274		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	GWASCAT_DG	31095341		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

HTR3A 2 shared diseasesAmphetamine or sympathomimetic abuse, Depression 2 shared evidence sourcesDisgenet (Amphetamine or sympathomimetic abuse), CTD (Amphetamine or sympathomimetic abuse) Related via 2 shared diseases including Amphetamine or sympathomimetic abuse, Depression — evidence mostly Disgenet. RAPGEF5 2 shared diseasesAmphetamine or sympathomimetic abuse, Depression 2 shared evidence sourcesDisgenet (Amphetamine or sympathomimetic abuse), CTD (Amphetamine or sympathomimetic abuse) Related via 2 shared diseases including Amphetamine or sympathomimetic abuse, Depression — evidence mostly Disgenet. TNKS 2 shared diseasesCervical cancer, Partial epilepsy 2 shared evidence sourcesGWAS catalog (Cervical cancer), GWAS catalog (Partial epilepsy) Related via 2 shared diseases including Cervical cancer, Partial epilepsy — evidence mostly GWAS catalog. DRD1 2 shared diseasesAmphetamine or sympathomimetic abuse, Depression 2 shared evidence sourcesDisgenet (Amphetamine or sympathomimetic abuse), CTD (Amphetamine or sympathomimetic abuse) Related via 2 shared diseases including Amphetamine or sympathomimetic abuse, Depression — evidence mostly Disgenet. PDE4B 2 shared diseasesAmphetamine or sympathomimetic abuse, Cervical cancer 4 shared evidence sourcesDisgenet (Amphetamine or sympathomimetic abuse), CTD (Amphetamine or sympathomimetic abuse), GWAS catalog (Cervical cancer), GWAS catalog (Heart failure) Related via 2 shared diseases including Amphetamine or sympathomimetic abuse, Cervical cancer — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
HTR3A	2	["Amphetamine or sympathomimetic abuse","Depression"]	0	[]	2	["Disgenet (Amphetamine or sympathomimetic abuse)","CTD (Amphetamine or sympathomimetic abuse)"]
RAPGEF5	2	["Amphetamine or sympathomimetic abuse","Depression"]	0	[]	2	["Disgenet (Amphetamine or sympathomimetic abuse)","CTD (Amphetamine or sympathomimetic abuse)"]
TNKS	2	["Cervical cancer","Partial epilepsy"]	0	[]	2	["GWAS catalog (Cervical cancer)","GWAS catalog (Partial epilepsy)"]
DRD1	2	["Amphetamine or sympathomimetic abuse","Depression"]	0	[]	2	["Disgenet (Amphetamine or sympathomimetic abuse)","CTD (Amphetamine or sympathomimetic abuse)"]
PDE4B	2	["Amphetamine or sympathomimetic abuse","Cervical cancer"]	0	[]	4	["Disgenet (Amphetamine or sympathomimetic abuse)","CTD (Amphetamine or sympathomimetic abuse)","GWAS catalog (Cervical cancer)","GWAS catalog (Heart failure)"]

Diseases Linked via Similar Genes

Autism Linked via 3 of 5 related genesHTR3A, DRD1, PDE4B Mood disorder Linked via 2 of 5 related genesHTR3A, PDE4B Multiple sclerosis Linked via 2 of 5 related genesHTR3A, PDE4B Color vision deficiency Linked via 2 of 5 related genesRAPGEF5, PDE4B Asthma Linked via 2 of 5 related genesTNKS, PDE4B

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Autism	3	["HTR3A","DRD1","PDE4B"]
Mood disorder	2	["HTR3A","PDE4B"]
Multiple sclerosis	2	["HTR3A","PDE4B"]
Color vision deficiency	2	["RAPGEF5","PDE4B"]
Asthma	2	["TNKS","PDE4B"]