ZNF184 (zinc finger protein 184)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 7738
• Gene name: Zinc finger protein 184
• Gene symbol: ZNF184
• Synonyms (NCBI Gene): kr-ZNF3
• Chromosome: 6
• Chromosome location: 6p22.1
• Summary: The protein encoded by this gene is predicted to be a Kruppel C2H2-type zinc-finger protein family member. Sequence analysis predicts that the protein contains two Kruppel associated box (KRAB) boxes in the N-terminus and highly conserved zinc finger moti

miRNA Show/Hide all (85)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024548	hsa-miR-215-5p	Microarray	19074876
MIRT026409	hsa-miR-192-5p	Microarray	19074876
MIRT1517257	hsa-miR-4495	CLIP-seq
MIRT1517258	hsa-miR-586	CLIP-seq
MIRT2156167	hsa-miR-3920	CLIP-seq
MIRT2375744	hsa-miR-3157-5p	CLIP-seq
MIRT2375745	hsa-miR-4263	CLIP-seq
MIRT2375746	hsa-miR-4690-3p	CLIP-seq
MIRT2375747	hsa-miR-4797-5p	CLIP-seq
MIRT2375748	hsa-miR-576-5p	CLIP-seq
MIRT2375749	hsa-miR-759	CLIP-seq
MIRT2668183	hsa-miR-1273d	CLIP-seq
MIRT2668184	hsa-miR-1323	CLIP-seq
MIRT2668185	hsa-miR-182	CLIP-seq
MIRT2668186	hsa-miR-2682	CLIP-seq
MIRT2668187	hsa-miR-300	CLIP-seq
MIRT2668188	hsa-miR-3120-3p	CLIP-seq
MIRT2375744	hsa-miR-3157-5p	CLIP-seq
MIRT2668189	hsa-miR-3171	CLIP-seq
MIRT2668190	hsa-miR-3606	CLIP-seq
MIRT2668191	hsa-miR-3647-3p	CLIP-seq
MIRT2668192	hsa-miR-3714	CLIP-seq
MIRT2668193	hsa-miR-381	CLIP-seq
MIRT2156167	hsa-miR-3920	CLIP-seq
MIRT2668194	hsa-miR-3922-5p	CLIP-seq
MIRT2375745	hsa-miR-4263	CLIP-seq
MIRT2668195	hsa-miR-4282	CLIP-seq
MIRT2668196	hsa-miR-4470	CLIP-seq
MIRT2668197	hsa-miR-449c	CLIP-seq
MIRT2668198	hsa-miR-4643	CLIP-seq
MIRT2668199	hsa-miR-466	CLIP-seq
MIRT2668200	hsa-miR-4666-3p	CLIP-seq
MIRT2375746	hsa-miR-4690-3p	CLIP-seq
MIRT2668201	hsa-miR-4698	CLIP-seq
MIRT2668202	hsa-miR-4719	CLIP-seq
MIRT2668203	hsa-miR-4728-3p	CLIP-seq
MIRT2668204	hsa-miR-4777-5p	CLIP-seq
MIRT2668205	hsa-miR-4789-3p	CLIP-seq
MIRT2375747	hsa-miR-4797-5p	CLIP-seq
MIRT2668206	hsa-miR-4799-5p	CLIP-seq
MIRT2668207	hsa-miR-498	CLIP-seq
MIRT2668208	hsa-miR-518d-5p	CLIP-seq
MIRT2668209	hsa-miR-519b-5p	CLIP-seq
MIRT2668210	hsa-miR-519c-5p	CLIP-seq
MIRT2668211	hsa-miR-520c-5p	CLIP-seq
MIRT2668212	hsa-miR-526a	CLIP-seq
MIRT2668213	hsa-miR-545	CLIP-seq
MIRT2668214	hsa-miR-548a-3p	CLIP-seq
MIRT2668215	hsa-miR-548e	CLIP-seq
MIRT2668216	hsa-miR-548f	CLIP-seq
MIRT2668217	hsa-miR-548o	CLIP-seq
MIRT2668218	hsa-miR-548p	CLIP-seq
MIRT2375748	hsa-miR-576-5p	CLIP-seq
MIRT2668219	hsa-miR-587	CLIP-seq
MIRT2668220	hsa-miR-605	CLIP-seq
MIRT2668221	hsa-miR-660	CLIP-seq
MIRT2375749	hsa-miR-759	CLIP-seq
MIRT2668183	hsa-miR-1273d	CLIP-seq
MIRT2668185	hsa-miR-182	CLIP-seq
MIRT2668188	hsa-miR-3120-3p	CLIP-seq
MIRT2375744	hsa-miR-3157-5p	CLIP-seq
MIRT2668189	hsa-miR-3171	CLIP-seq
MIRT2668190	hsa-miR-3606	CLIP-seq
MIRT2668191	hsa-miR-3647-3p	CLIP-seq
MIRT2668195	hsa-miR-4282	CLIP-seq
MIRT2668196	hsa-miR-4470	CLIP-seq
MIRT2668198	hsa-miR-4643	CLIP-seq
MIRT2668199	hsa-miR-466	CLIP-seq
MIRT2375746	hsa-miR-4690-3p	CLIP-seq
MIRT2668201	hsa-miR-4698	CLIP-seq
MIRT2668202	hsa-miR-4719	CLIP-seq
MIRT2668203	hsa-miR-4728-3p	CLIP-seq
MIRT2668204	hsa-miR-4777-5p	CLIP-seq
MIRT2668205	hsa-miR-4789-3p	CLIP-seq
MIRT2375747	hsa-miR-4797-5p	CLIP-seq
MIRT2668208	hsa-miR-518d-5p	CLIP-seq
MIRT2668209	hsa-miR-519b-5p	CLIP-seq
MIRT2668210	hsa-miR-519c-5p	CLIP-seq
MIRT2668211	hsa-miR-520c-5p	CLIP-seq
MIRT2668212	hsa-miR-526a	CLIP-seq
MIRT2668213	hsa-miR-545	CLIP-seq
MIRT2668218	hsa-miR-548p	CLIP-seq
MIRT2668219	hsa-miR-587	CLIP-seq
MIRT2668221	hsa-miR-660	CLIP-seq
MIRT2375749	hsa-miR-759	CLIP-seq

Gene ontology (GO) Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	NAS	9073517
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 602277
• HGNC: 12975
• e!Ensembl: ENSG00000096654

Protein

• UniProt ID: Q99676
• Protein name: Zinc finger protein 184
• Protein function: May be involved in transcriptional regulation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	418 → 440	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	250 → 272	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	306 → 328	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	502 → 524	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	726 → 748	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	530 → 552	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	670 → 692	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	642 → 664	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	362 → 384	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	446 → 468	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	474 → 496	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	334 → 356	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	586 → 608	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	222 → 244	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	614 → 636	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	558 → 580	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	390 → 412	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	698 → 720	Zinc finger, C2H2 type	Domain
  PF01352	KRAB	27 → 68	KRAB box	Family

• Tissue specificity: TISSUE SPECIFICITY: Predominant expression in testis.
• Sequence:

  MEDLSSPDSTLLQGGHNLLSSASFQEAVTFKDVIVDFTQEEWKQLDPGQRDLFRDVTLEN
  YTHLVSIGLQVSKPDVISQLEQGTEPWIMEPSIPVGTCADWETRLENSVSAPEPDISEEE
  LSPEVIVEKHKRDDSWSSNLLESWEYEGSLERQQANQQTLPKEIKVTEKTIPSWEKGPVN
  NEFGKSVNVSSNLVTQEPSPEETSTKRSIKQNSNPVKKEKSCKCNECGKAFSYCSALIRH
  QRTHTGEKPYKCNECEKAFSRSENLINHQRIHTGDKPYKCDQCGKGFIEGPSLTQHQRIH
  TGEKPYKCDECGKAFSQRTHLVQHQRIHTGEKPYTCNECGKAFSQRGHFMEHQKIHTGEK
  PFKCDECDKTFTRSTHLTQHQKIHTGEKTYKCNECGKAFNGPSTFIRHHMIHTGEKPYEC
  NECGKAFSQHSNLTQHQKTHTGEKPYDCAECGKSFSYWSSLAQHLKIHTGEKPYKCNECG
  KAFSYCSSLTQHRRIHTREKPFECSECGKAFSYLSNLNQHQKTHTQEKAYECKECGKAFI
  RSSSLAKHERIHTGEKPYQCHECGKTFSYGSSLIQHRKIHTGERPYKCNECGRAFNQNIH
  LTQHKRIHTGAKPYECAECGKAFRHCSSLAQHQKTHTEEKPYQCNKCEKTFSQSSHLTQH
  QRIHTGEKPYKCNECDKAFSRSTHLTEHQNTHTGEKPYNCNECRKTFSQSTYLIQHQRIH
  SGEKPFGCNDCGKSFRYRSALNKHQRLHPGI

• Sequence length: 751

Pathways

Reactome Pathway:

Generic Transcription Pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (24)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	38184787	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	34446935	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	28115744	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	29059683	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	29059683	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	GWAS catalog	37156939	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	39789286	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	33356394	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTHYROIDISM	—	GWAS catalog	39789286	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	28604730	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	28604730	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	28604730	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	29292387, 29662059, 29942085, 30643256, 32231276, 33859377, 34634379, 35898629, 36750733, 37985818, 38858783, 41233554	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	30643256, 32231276	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	36137488	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	38637617	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	38757301, 39885523	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	28604730	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	28604730	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	34446935	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	33667223	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma of lung	Lung carcinoma	BEFREE	27565901		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27565901		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29691093, 30814023		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	32139796	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

HMGN4 3 shared diseasesCannabis abuse, Post-traumatic stress disorder, Upper aerodigestive tract neoplasm 3 shared evidence sourcesGWAS catalog (Cannabis abuse), GWAS catalog (Post-traumatic stress disorder), GWAS catalog (Upper aerodigestive tract neoplasm) Related via 3 shared diseases including Cannabis abuse, Post-traumatic stress disorder — evidence mostly GWAS catalog. LSM8 2 shared diseasesCannabis abuse, Post-traumatic stress disorder 2 shared evidence sourcesGWAS catalog (Cannabis abuse), GWAS catalog (Post-traumatic stress disorder) Related via 2 shared diseases including Cannabis abuse, Post-traumatic stress disorder — evidence mostly GWAS catalog. OR11A1 2 shared diseasesPost-traumatic stress disorder, Upper aerodigestive tract neoplasm 2 shared evidence sourcesGWAS catalog (Post-traumatic stress disorder), GWAS catalog (Upper aerodigestive tract neoplasm) Related via 2 shared diseases including Post-traumatic stress disorder, Upper aerodigestive tract neoplasm — evidence mostly GWAS catalog. ABT1 3 shared diseasesCannabis abuse, Post-traumatic stress disorder, Upper aerodigestive tract neoplasm 3 shared evidence sourcesGWAS catalog (Cannabis abuse), GWAS catalog (Post-traumatic stress disorder), GWAS catalog (Upper aerodigestive tract neoplasm) Related via 3 shared diseases including Cannabis abuse, Post-traumatic stress disorder — evidence mostly GWAS catalog. BTN1A1 2 shared diseasesCannabis abuse, Upper aerodigestive tract neoplasm 2 shared evidence sourcesGWAS catalog (Cannabis abuse), GWAS catalog (Upper aerodigestive tract neoplasm) Related via 2 shared diseases including Cannabis abuse, Upper aerodigestive tract neoplasm — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
HMGN4	3	["Cannabis abuse","Post-traumatic stress disorder","Upper aerodigestive tract neoplasm"]	0	[]	3	["GWAS catalog (Cannabis abuse)","GWAS catalog (Post-traumatic stress disorder)","GWAS catalog (Upper aerodigestive tract neoplasm)"]
LSM8	2	["Cannabis abuse","Post-traumatic stress disorder"]	0	[]	2	["GWAS catalog (Cannabis abuse)","GWAS catalog (Post-traumatic stress disorder)"]
OR11A1	2	["Post-traumatic stress disorder","Upper aerodigestive tract neoplasm"]	0	[]	2	["GWAS catalog (Post-traumatic stress disorder)","GWAS catalog (Upper aerodigestive tract neoplasm)"]
ABT1	3	["Cannabis abuse","Post-traumatic stress disorder","Upper aerodigestive tract neoplasm"]	0	[]	3	["GWAS catalog (Cannabis abuse)","GWAS catalog (Post-traumatic stress disorder)","GWAS catalog (Upper aerodigestive tract neoplasm)"]
BTN1A1	2	["Cannabis abuse","Upper aerodigestive tract neoplasm"]	0	[]	2	["GWAS catalog (Cannabis abuse)","GWAS catalog (Upper aerodigestive tract neoplasm)"]

Diseases Linked via Similar Genes

Irritable bowel syndrome Linked via 3 of 5 related genesHMGN4, OR11A1, ABT1 Schizophrenia Linked via 3 of 5 related genesHMGN4, OR11A1, ABT1 Autism Linked via 2 of 5 related genesHMGN4, OR11A1 Dental caries Linked via 2 of 5 related genesHMGN4, ABT1 Inflammatory bowel disease Linked via 2 of 5 related genesHMGN4, ABT1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Irritable bowel syndrome	3	["HMGN4","OR11A1","ABT1"]
Schizophrenia	3	["HMGN4","OR11A1","ABT1"]
Autism	2	["HMGN4","OR11A1"]
Dental caries	2	["HMGN4","ABT1"]
Inflammatory bowel disease	2	["HMGN4","ABT1"]