Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	7484
Gene name	Wnt family member 9B
Gene symbol	WNT9B
Synonyms (NCBI Gene)	WNT14BWNT15
Chromosome	17
Chromosome location	17q21.32
Summary	The WNT gene family consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryoge

49 Show/Hide all (49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004682	hsa-miR-324-3p	Luciferase reporter assay	19478946
MIRT651506	hsa-miR-5193	HITS-CLIP	23824327
MIRT651507	hsa-miR-513a-5p	HITS-CLIP	23824327
MIRT651505	hsa-miR-27a-3p	HITS-CLIP	23824327
MIRT651504	hsa-miR-27b-3p	HITS-CLIP	23824327
MIRT651503	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT442335	hsa-miR-3614-5p	PAR-CLIP	22100165
MIRT442334	hsa-miR-5189-3p	PAR-CLIP	22100165
MIRT442333	hsa-miR-4271	PAR-CLIP	22100165
MIRT442332	hsa-miR-4725-3p	PAR-CLIP	22100165
MIRT442330	hsa-miR-6780b-5p	PAR-CLIP	22100165
MIRT442331	hsa-miR-625-5p	PAR-CLIP	22100165
MIRT442329	hsa-miR-4723-5p	PAR-CLIP	22100165
MIRT442328	hsa-miR-5698	PAR-CLIP	22100165
MIRT442327	hsa-miR-6870-5p	PAR-CLIP	22100165
MIRT442326	hsa-miR-7111-5p	PAR-CLIP	22100165
MIRT442325	hsa-miR-4525	PAR-CLIP	22100165
MIRT442323	hsa-miR-5010-5p	PAR-CLIP	22100165
MIRT442324	hsa-miR-4436b-5p	PAR-CLIP	22100165
MIRT442322	hsa-miR-1275	PAR-CLIP	22100165
MIRT442321	hsa-miR-4665-5p	PAR-CLIP	22100165
MIRT442320	hsa-miR-7109-5p	PAR-CLIP	22100165
MIRT442319	hsa-miR-6751-5p	PAR-CLIP	22100165
MIRT442318	hsa-miR-6803-5p	PAR-CLIP	22100165
MIRT736836	hsa-miR-20b-5p	Luciferase reporter assayWestern blottingqRT-PCR	31867895
MIRT651506	hsa-miR-5193	HITS-CLIP	23824327
MIRT651507	hsa-miR-513a-5p	HITS-CLIP	23824327
MIRT651505	hsa-miR-27a-3p	HITS-CLIP	23824327
MIRT651504	hsa-miR-27b-3p	HITS-CLIP	23824327
MIRT651503	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT442335	hsa-miR-3614-5p	PAR-CLIP	22100165
MIRT442334	hsa-miR-5189-3p	PAR-CLIP	22100165
MIRT442333	hsa-miR-4271	PAR-CLIP	22100165
MIRT442332	hsa-miR-4725-3p	PAR-CLIP	22100165
MIRT442330	hsa-miR-6780b-5p	PAR-CLIP	22100165
MIRT442331	hsa-miR-625-5p	PAR-CLIP	22100165
MIRT442329	hsa-miR-4723-5p	PAR-CLIP	22100165
MIRT442328	hsa-miR-5698	PAR-CLIP	22100165
MIRT442327	hsa-miR-6870-5p	PAR-CLIP	22100165
MIRT442326	hsa-miR-7111-5p	PAR-CLIP	22100165
MIRT442325	hsa-miR-4525	PAR-CLIP	22100165
MIRT442323	hsa-miR-5010-5p	PAR-CLIP	22100165
MIRT442324	hsa-miR-4436b-5p	PAR-CLIP	22100165
MIRT442322	hsa-miR-1275	PAR-CLIP	22100165
MIRT442321	hsa-miR-4665-5p	PAR-CLIP	22100165
MIRT442320	hsa-miR-7109-5p	PAR-CLIP	22100165
MIRT442319	hsa-miR-6751-5p	PAR-CLIP	22100165
MIRT442318	hsa-miR-6803-5p	PAR-CLIP	22100165
MIRT2148880	hsa-miR-4639-3p	CLIP-seq

46 Show/Hide all (46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001822	Process	Kidney development	IEA
GO:0003339	Process	Regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005109	Function	Frizzled binding	IBA
GO:0005125	Function	Cytokine activity	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0009267	Process	Cellular response to starvation	IEA
GO:0009786	Process	Regulation of asymmetric cell division	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	ISS
GO:0030539	Process	Male genitalia development	IEA
GO:0032526	Process	Response to retinoic acid	NAS	11604992
GO:0035150	Process	Regulation of tube size	IEA
GO:0035567	Process	Non-canonical Wnt signaling pathway	IDA	25640183
GO:0039706	Function	Co-receptor binding	IEA
GO:0045165	Process	Cell fate commitment	IBA
GO:0048018	Function	Receptor ligand activity	IDA	28733458
GO:0048701	Process	Embryonic cranial skeleton morphogenesis	IEA
GO:0048754	Process	Branching morphogenesis of an epithelial tube	IEA
GO:0060021	Process	Roof of mouth development	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	28733458
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	IEA
GO:0060993	Process	Kidney morphogenesis	IEA
GO:0061038	Process	Uterus morphogenesis	IEA
GO:0061303	Process	Cornea development in camera-type eye	ISS	16258938
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:0072003	Process	Kidney rudiment formation	IEA
GO:0072038	Process	Mesenchymal stem cell maintenance involved in nephron morphogenesis	IEA
GO:0072044	Process	Collecting duct development	IEA
GO:0072046	Process	Establishment of planar polarity involved in nephron morphogenesis	IEA
GO:0072078	Process	Nephron tubule morphogenesis	IEA
GO:0072164	Process	Mesonephric tubule development	IEA
GO:0072170	Process	Metanephric tubule development	IEA
GO:0072174	Process	Metanephric tubule formation	IEA
GO:0072181	Process	Mesonephric duct formation	IEA
GO:1902455	Process	Negative regulation of stem cell population maintenance	IMP	25640183
GO:1904948	Process	Midbrain dopaminergic neuron differentiation	IMP	25640183

MIM	HGNC	e!Ensembl
602864	12779	ENSG00000158955

O14905

Protein name

Protein Wnt-9b (Protein Wnt-14b) (Protein Wnt-15)

Protein function

Ligand for members of the frizzled family of seven transmembrane receptors (Probable). Functions in the canonical Wnt/beta-catenin signaling pathway. Required for normal embryonic kidney development, and for normal development of the urogenital

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00110	wnt	56 → 356	wnt family	Family

Tissue specificity

TISSUE SPECIFICITY: Moderately expressed in fetal kidney and adult kidney. Also found in brain.

Sequence

MRPPPALALAGLCLLALPAAAASYFGLTGREVLTPFPGLGTAAAPAQGGAHLKQCDLLKL
SRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRHERWNCSLEGRMGLLKRGFKETAFLY
AVSSAALTHTLARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSK
RGNKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLKL
RYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGDLVYMEDSPSFCRPSKYSPGT
AGRVCSREASCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCVQEELVYTCKH

Sequence length

357

Interactions

View interactions

KEGG Pathway	Reactome Pathway
mTOR signaling pathway	WNT ligand biogenesis and trafficking
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
Cushing syndrome
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Human papillomavirus infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Chronic kidney disease	Likely pathogenic	rs753748759, rs1291189006	RCV001849868 RCV001849869	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cystic renal dysplasia	Likely pathogenic	rs753748759	RCV001849868	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Renal dysplasia	Likely pathogenic	rs1291189006	RCV001849869	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Renal hypoplasia	Likely pathogenic	rs1291189006	RCV001849869	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (19)
ANTI-NEUTROPHIL ANTIBODY ASSOCIATED VASCULITIS	—	GWAS catalog	22808956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASES	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ABSENCE OF KIDNEYS SYNDROME	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HYPOPLASIA OF KIDNEY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	33020668	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC DYSPLASIA OF KIDNEY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART SEPTAL DEFECT	—	GWAS catalog	38454350	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	38965376, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	33704824	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	37386247	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	33137956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WNT9B-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (13)
Basal Cell Nevus Syndrome	Basal cell nevus syndrome	Pubtator	28915250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Exstrophy	Bladder Exstrophy	BEFREE	24852367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	24437584, 35191549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	16998816, 24437584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	24437584, 30870065, 31063268, 31122291, 35191549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	12011973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	35697867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	33704824	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Orofacial Cleft 1	Orofacial cleft	Pubtator	18413325, 20890934, 24437584, 28232668, 35191549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Otofaciocervical Syndrome	Otofaciocervical syndrome	Pubtator	35191549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical periodontitis	Pubtator	31831777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	31831777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	16998816		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
WNT2	[]	12	["mTOR signaling pathway","Wnt signaling pathway","Hippo signaling pathway","Signaling pathways regulating pluripotency of stem cells","Melanogenesis","Cushing syndrome","Proteoglycans in cancer","Basal cell carcinoma","Breast cancer","Hepatocellular carcinoma","Gastric cancer","WNT ligand biogenesis and trafficking"]	[]
WNT6	[]	12	["mTOR signaling pathway","Wnt signaling pathway","Hippo signaling pathway","Signaling pathways regulating pluripotency of stem cells","Melanogenesis","Cushing syndrome","Proteoglycans in cancer","Basal cell carcinoma","Breast cancer","Hepatocellular carcinoma","Gastric cancer","WNT ligand biogenesis and trafficking"]	[]
WNT7A	[]	12	["mTOR signaling pathway","Wnt signaling pathway","Hippo signaling pathway","Signaling pathways regulating pluripotency of stem cells","Melanogenesis","Cushing syndrome","Proteoglycans in cancer","Basal cell carcinoma","Breast cancer","Hepatocellular carcinoma","Gastric cancer","WNT ligand biogenesis and trafficking"]	[]
WNT7B	[]	12	["mTOR signaling pathway","Wnt signaling pathway","Hippo signaling pathway","Signaling pathways regulating pluripotency of stem cells","Melanogenesis","Cushing syndrome","Proteoglycans in cancer","Basal cell carcinoma","Breast cancer","Hepatocellular carcinoma","Gastric cancer","WNT ligand biogenesis and trafficking"]	[]
WNT10B	[]	12	["mTOR signaling pathway","Wnt signaling pathway","Hippo signaling pathway","Signaling pathways regulating pluripotency of stem cells","Melanogenesis","Cushing syndrome","Proteoglycans in cancer","Basal cell carcinoma","Breast cancer","Hepatocellular carcinoma","Gastric cancer","WNT ligand biogenesis and trafficking"]	[]

WNT9B (Wnt family member 9B)

Save This Analysis