VEGFD (vascular endothelial growth factor D)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 2277
Gene name Vascular endothelial growth factor D
Gene symbol VEGFD
Synonyms (NCBI Gene)
FIGFVEGF-D
Chromosome X
Chromosome location Xp22.2
Summary The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family and is active in angiogenesis, lymphangiogenesis, and endothelial cell growth. This secreted protein undergoes a compl
Transcription factors Transcription factors information provided by TRRUST V2 database.
4
Download as csvDownload as pdf
Transcription factor Regulation Reference
FOS Unknown 19136250
JUN Unknown 19136250
NFKB1 Activation 18941249
RELA Activation 18941249
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
38 Show/Hide all (38)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0001666 Process Response to hypoxia IBA
GO:0002040 Process Sprouting angiogenesis IBA
GO:0005161 Function Platelet-derived growth factor receptor binding TAS 9479493
GO:0005172 Function Vascular endothelial growth factor receptor binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300091 3708 ENSG00000165197
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43915
Protein name Vascular endothelial growth factor D (VEGF-D) (c-Fos-induced growth factor) (FIGF)
Protein function Growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in the formation of the venous and lymphat
PDB 2XV7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00341 PDGF 111 → 191 PDGF/VEGF domain Domain
PF03128 CXCXC 262 → 273 CXCXC repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Highly expressed in lung, heart, small intestine and fetal lung, and at lower levels in skeletal muscle, colon, and pancreas.
Sequence 
MYREWVVVNVFMMLYVQLVQGSSNEHGPVKRSSQSTLERSEQQIRAASSLEELLRITHSE
DWKLWRCRLRLKSFTSMDSRSASHRSTRFAATFYDIETLKVIDEEWQRTQCSPRETCVEV
ASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVP
VKVANHTGCKCLPTAPRHPYSIIRRSIQIPEEDRCSHSKKLCPIDMLWDSNKCKCVLQEE
NPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETC
CQKHKLFHPDTCSCEDRCPFHTRPCASGKTACAKHCRFPKEKRAAQGPHSRKNP
Sequence length 354
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
MAPK signaling pathway Platelet degranulation
Ras signaling pathway VEGF ligand-receptor interactions
Rap1 signaling pathway VEGF binds to VEGFR leading to receptor dimerization
Calcium signaling pathway  
PI3K-Akt signaling pathway  
Focal adhesion  
TNF signaling pathway  
Relaxin signaling pathway  
AGE-RAGE signaling pathway in diabetic complications  
Pathways in cancer  
Sort by:
VEGFC 11 shared pathwaysMAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Focal adhesion, TNF signaling pathway, Relaxin signaling pathway, AGE-RAGE signaling pathway in diabetic complications, Platelet degranulation , VEGF ligand-receptor interactions, VEGF binds to VEGFR leading to receptor dimerization Related via 11 shared pathways including MAPK signaling pathway, Ras signaling pathway. VEGFB 10 shared pathwaysMAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Focal adhesion, Relaxin signaling pathway, AGE-RAGE signaling pathway in diabetic complications, Platelet degranulation , VEGF ligand-receptor interactions, VEGF binds to VEGFR leading to receptor dimerization Related via 10 shared pathways including MAPK signaling pathway, Ras signaling pathway. PGF 6 shared pathwaysMAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Focal adhesion, VEGF ligand-receptor interactions, VEGF binds to VEGFR leading to receptor dimerization Related via 6 shared pathways including MAPK signaling pathway, Ras signaling pathway. FLT4 6 shared pathwaysMAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Focal adhesion, VEGF binds to VEGFR leading to receptor dimerization Related via 6 shared pathways including MAPK signaling pathway, Ras signaling pathway. FLT1 6 shared pathwaysMAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Focal adhesion, VEGF binds to VEGFR leading to receptor dimerization Related via 6 shared pathways including MAPK signaling pathway, Ras signaling pathway.
Breast neoplasms Linked via 3 of 5 related genesVEGFC, VEGFB, FLT1 Myocardial infarction Linked via 3 of 5 related genesVEGFB, PGF, FLT1 Obstructive pulmonary disease Linked via 2 of 5 related genesVEGFC, FLT1 Hemangiosarcoma Linked via 2 of 5 related genesVEGFC, FLT1 Lymphatic malformation Linked via 2 of 5 related genesVEGFC, FLT4