VEGFB (vascular endothelial growth factor B)

Gene

• Entrez ID: 7423
• Gene name: Vascular endothelial growth factor B
• Gene symbol: VEGFB
• Synonyms (NCBI Gene): VEGFL, VRF
• Chromosome: 11
• Chromosome location: 11q13.1
• Summary: This gene encodes a member of the PDGF (platelet-derived growth factor)/VEGF (vascular endothelial growth factor) family. The VEGF family members regulate the formation of blood vessels and are involved in endothelial cell physiology. This member is a lig

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT651751	hsa-miR-361-5p	HITS-CLIP	23824327
MIRT651750	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT651749	hsa-miR-6808-5p	HITS-CLIP	23824327
MIRT651748	hsa-miR-6893-5p	HITS-CLIP	23824327
MIRT651747	hsa-miR-940	HITS-CLIP	23824327
MIRT651746	hsa-miR-7845-5p	HITS-CLIP	23824327
MIRT651745	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT651744	hsa-miR-4514	HITS-CLIP	23824327
MIRT651743	hsa-miR-4692	HITS-CLIP	23824327
MIRT651742	hsa-miR-211-3p	HITS-CLIP	23824327
MIRT651741	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT651740	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT651739	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT651738	hsa-miR-4448	HITS-CLIP	23824327
MIRT651737	hsa-miR-1207-5p	HITS-CLIP	23824327
MIRT651736	hsa-miR-4763-3p	HITS-CLIP	23824327
MIRT651735	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT651734	hsa-miR-374a-3p	HITS-CLIP	23824327
MIRT651751	hsa-miR-361-5p	HITS-CLIP	23824327
MIRT651750	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT651749	hsa-miR-6808-5p	HITS-CLIP	23824327
MIRT651748	hsa-miR-6893-5p	HITS-CLIP	23824327
MIRT651747	hsa-miR-940	HITS-CLIP	23824327
MIRT651746	hsa-miR-7845-5p	HITS-CLIP	23824327
MIRT651745	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT651744	hsa-miR-4514	HITS-CLIP	23824327
MIRT651743	hsa-miR-4692	HITS-CLIP	23824327
MIRT651742	hsa-miR-211-3p	HITS-CLIP	23824327
MIRT651741	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT651740	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT651739	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT651738	hsa-miR-4448	HITS-CLIP	23824327
MIRT651737	hsa-miR-1207-5p	HITS-CLIP	23824327
MIRT651736	hsa-miR-4763-3p	HITS-CLIP	23824327
MIRT651735	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT651734	hsa-miR-374a-3p	HITS-CLIP	23824327
MIRT755508	hsa-miR-5194	Luciferase reporter assay, Western blotting, qRT-PCR	37215458
MIRT755508	hsa-miR-5194	Luciferase reporter assay, Western blotting, qRT-PCR	37215458
MIRT1483896	hsa-miR-1233	CLIP-seq
MIRT1483897	hsa-miR-298	CLIP-seq
MIRT2145650	hsa-miR-224	CLIP-seq
MIRT2145651	hsa-miR-3620	CLIP-seq
MIRT2145652	hsa-miR-370	CLIP-seq
MIRT2145653	hsa-miR-4663	CLIP-seq
MIRT2145654	hsa-miR-4766-5p	CLIP-seq
MIRT2145655	hsa-miR-627	CLIP-seq
MIRT2145656	hsa-miR-924	CLIP-seq
MIRT2659678	hsa-miR-101	CLIP-seq
MIRT1483896	hsa-miR-1233	CLIP-seq
MIRT2659679	hsa-miR-1236	CLIP-seq
MIRT2659680	hsa-miR-125a-5p	CLIP-seq
MIRT2659681	hsa-miR-125b	CLIP-seq
MIRT2659682	hsa-miR-1266	CLIP-seq
MIRT2659683	hsa-miR-136	CLIP-seq
MIRT1483897	hsa-miR-298	CLIP-seq
MIRT2659684	hsa-miR-3145-5p	CLIP-seq
MIRT2659685	hsa-miR-3160-3p	CLIP-seq
MIRT2659686	hsa-miR-331-3p	CLIP-seq
MIRT2659687	hsa-miR-3664-5p	CLIP-seq
MIRT2659688	hsa-miR-3682-3p	CLIP-seq
MIRT2659689	hsa-miR-3921	CLIP-seq
MIRT2659690	hsa-miR-4251	CLIP-seq
MIRT2659691	hsa-miR-4270	CLIP-seq
MIRT2659692	hsa-miR-4279	CLIP-seq
MIRT2659693	hsa-miR-4319	CLIP-seq
MIRT2659694	hsa-miR-4329	CLIP-seq
MIRT2659695	hsa-miR-4441	CLIP-seq
MIRT2659696	hsa-miR-4487	CLIP-seq
MIRT2659697	hsa-miR-4501	CLIP-seq
MIRT2659698	hsa-miR-4518	CLIP-seq
MIRT2659699	hsa-miR-4645-3p	CLIP-seq
MIRT2659700	hsa-miR-4653-5p	CLIP-seq
MIRT2659701	hsa-miR-4687-5p	CLIP-seq
MIRT2659702	hsa-miR-4713-5p	CLIP-seq
MIRT2659703	hsa-miR-4726-3p	CLIP-seq
MIRT2659704	hsa-miR-4757-5p	CLIP-seq
MIRT2659705	hsa-miR-4774-5p	CLIP-seq
MIRT2659706	hsa-miR-508-5p	CLIP-seq
MIRT2659707	hsa-miR-558	CLIP-seq
MIRT2659678	hsa-miR-101	CLIP-seq
MIRT1483896	hsa-miR-1233	CLIP-seq
MIRT2659679	hsa-miR-1236	CLIP-seq
MIRT2659680	hsa-miR-125a-5p	CLIP-seq
MIRT2659681	hsa-miR-125b	CLIP-seq
MIRT2659682	hsa-miR-1266	CLIP-seq
MIRT2659683	hsa-miR-136	CLIP-seq
MIRT1483897	hsa-miR-298	CLIP-seq
MIRT2659684	hsa-miR-3145-5p	CLIP-seq
MIRT2659685	hsa-miR-3160-3p	CLIP-seq
MIRT2659686	hsa-miR-331-3p	CLIP-seq
MIRT2659687	hsa-miR-3664-5p	CLIP-seq
MIRT2659688	hsa-miR-3682-3p	CLIP-seq
MIRT2659691	hsa-miR-4270	CLIP-seq
MIRT2659692	hsa-miR-4279	CLIP-seq
MIRT2659693	hsa-miR-4319	CLIP-seq
MIRT2659695	hsa-miR-4441	CLIP-seq
MIRT2659696	hsa-miR-4487	CLIP-seq
MIRT2659697	hsa-miR-4501	CLIP-seq
MIRT2659698	hsa-miR-4518	CLIP-seq
MIRT2659699	hsa-miR-4645-3p	CLIP-seq
MIRT2659701	hsa-miR-4687-5p	CLIP-seq
MIRT2659702	hsa-miR-4713-5p	CLIP-seq
MIRT2659704	hsa-miR-4757-5p	CLIP-seq
MIRT2659705	hsa-miR-4774-5p	CLIP-seq
MIRT2659706	hsa-miR-508-5p	CLIP-seq
MIRT2659707	hsa-miR-558	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOXM1	Unknown	21860419
FOXO3	Unknown	21860419
HDGF	Activation	14662017
HIF1A	Unknown	21731766
STAT3	Unknown	16899623;21731766
WT1	Unknown	17127464
YY1	Activation	20660740

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IBA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	8637916, 11122379
GO:0002040	Process	Sprouting angiogenesis	IBA
GO:0005172	Function	Vascular endothelial growth factor receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	11122379, 19483306, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	8637916, 12881472
GO:0006493	Process	Protein O-linked glycosylation	IEA
GO:0007507	Process	Heart development	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008201	Function	Heparin binding	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0010629	Process	Negative regulation of gene expression	IDA	18259607
GO:0016020	Component	Membrane	IEA
GO:0030949	Process	Positive regulation of vascular endothelial growth factor receptor signaling pathway	IDA	18259607
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0035470	Process	Positive regulation of vascular wound healing	IDA	16109918
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IBA
GO:0042056	Function	Chemoattractant activity	IBA
GO:0042056	Function	Chemoattractant activity	IDA	19275959
GO:0042802	Function	Identical protein binding	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	18259607
GO:0043117	Process	Positive regulation of vascular permeability	IDA	16109918
GO:0043183	Function	Vascular endothelial growth factor receptor 1 binding	IPI	12366396, 16109918
GO:0043524	Process	Negative regulation of neuron apoptotic process	IDA	18259607
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IBA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	11122379
GO:0050918	Process	Positive chemotaxis	IEA
GO:0050930	Process	Induction of positive chemotaxis	IBA
GO:0050930	Process	Induction of positive chemotaxis	IDA	19275959
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	18259607
GO:0060048	Process	Cardiac muscle contraction	IEA
GO:0060754	Process	Positive regulation of mast cell chemotaxis	IBA
GO:0060754	Process	Positive regulation of mast cell chemotaxis	IDA	19275959
GO:0060976	Process	Coronary vasculature development	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	18259607

Other IDs

• MIM: 601398
• HGNC: 12681
• e!Ensembl: ENSG00000173511

Protein

• UniProt ID: P49765
• Protein name: Vascular endothelial growth factor B (VEGF-B) (VEGF-related factor) (VRF)
• Protein function: Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis.
• PDB: 2C7W, 2VWE, 2XAC, 6TKK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00341	PDGF	47 → 124	PDGF/VEGF domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in all tissues except liver. Highest levels found in heart, skeletal muscle and pancreas.
• Sequence:

  MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVEL
  MGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHS
  QCECRPKKKDSAVKPDRAATPHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAP
  STTSALTPGPAAAAADAAASSVAKGGA

• Sequence length: 207

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenoma	Adenoma	BEFREE	12754739, 28110235		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31332262	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36680854, 36905877, 37354922	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11303624		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	30420902		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	30420902	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15107801		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	19424629		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	23146280		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10551327	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	12754739		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34845413, 36157115	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	19424629		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28335793		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	28314760		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36875456	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	39527375	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30021192		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26355232, 32429465	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34096454, 39527375	Stimulate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28314760		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11846206		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	20937974		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28314760		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28314760		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28523459		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	28314760		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28190774		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	32836220	Associate	★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	30886832		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	12942123, 30886832		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	12942123	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	31322068	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	20367336		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	27064391		★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	18317782	Associate	★☆☆☆☆ Found in Text Mining only
Genital ulcers	Genital ulcers	BEFREE	30420902		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	35695550	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	26988898	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	26988898	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28744448		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28744448		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	24448490		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28314760		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	39684876	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	36564776	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28314760		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	22471305	Inhibit	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30088238		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18537151		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18537151		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11241411		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	23146280		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	12942123, 30886832		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28335793		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	9426398		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	24604347		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27705937		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15107801, 28335793		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	19424629, 23728940		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21124841, 24604347		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	23146280		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	23146280		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	23146280		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30087698		★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	18923022		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	30392834	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	34852710	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	20019242		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	20937974, 24448490		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	10451490, 11241411, 11303624, 12754739, 15107801, 18537151, 21124841, 21194429, 22178229, 22872519, 24604347, 28110235, 30700502, 31601958		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	18923022		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	17611651		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25424698		★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Osteonecrosis	Pubtator	22035487	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23965899	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27705937		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	24604347		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15952180	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	28335793		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11306510, 11846206		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	12580897		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32754268	Associate	★☆☆☆☆ Found in Text Mining only
Thrombophlebitis	Thrombophlebitis	Pubtator	30420902	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29969324		★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	30420902	Associate	★☆☆☆☆ Found in Text Mining only